Clustal X 8) multiple sequence alignment




Дата канвертавання24.04.2016
Памер59.49 Kb.
CLUSTAL X (1.8) multiple sequence alignment

Ara-OBGL --------MASISINCFFTPQALARPSR---TRKIFAKPDKVSGRTRSPRKTKLQ-----

Vitis-OBGL ---------MSSSLSICFSPVSLARPT----TRKANPKKLPRNPNPNPNPNPKIR-----

Oryza-OBGL MAPAVAVVAAAAAFPFRLFSAEARRNTKGSRSKRGSARPLKPSPPPRPSASSSAAGGGGA

Popu-OBGL ------------------------------------------------------------

Physco-OBGL ------------------------------------------------------------

Chlamy-OBGL ------------------------------------------------------------

Ostreo-OBGL ------------------------------------------------------------

Syne-OBGL ------------------------------------------------------------

Synec-OBGL ------------------------------------------------------------

Nostoc-OBGL ------------------------------------------------------------

Bacil-OBGL ------------------------------------------------------------

Sphaero-OBGL ------------------------------------------------------------

Chloro-OBGL ------------------------------------------------------------

Listeria-OBGL ------------------------------------------------------------

Clost-OBGL ------------------------------------------------------------

Saccharomyces-Sar1 ------------------------------------------------------------

Neurospora-Sar1 ------------------------------------------------------------

Drosophila-Sar1 ------------------------------------------------------------

Ostreo-Sar1 ------------------------------------------------------------

Physco-Sar1 ------------------------------------------------------------

Ara-Sar1 ------------------------------------------------------------

Oryza-Sar1 ------------------------------------------------------------

Ara-OBGL -----------------------------REVELKSRGGDKLQPVSDAGGE---------

Vitis-OBGL -----------------------------KRTGTRTTSPNEVLPYGDQ------------

Oryza-OBGL TTFTRLPLRNAPASVEVTLDRFPTANPEPRASTFTRRNGERLGDDEEDEEEEEDEVELGL

Popu-OBGL ------------------------------------------------------------

Physco-OBGL ------------------------------------------------------------

Chlamy-OBGL ------------------------------------------------------------

Ostreo-OBGL -----------------------------MAYDPSDTLSDVLRRADEAR-S---------

Syne-OBGL ------------------------------------------------------------

Synec-OBGL ------------------------------------------------------------

Nostoc-OBGL ------------------------------------------------------------

Bacil-OBGL ------------------------------------------------------------

Sphaero-OBGL ------------------------------------------------------------

Chloro-OBGL ------------------------------------------------------------

Listeria-OBGL ------------------------------------------------------------

Clost-OBGL ------------------------------------------------------------

Saccharomyces-Sar1 ------------------------------------------------------------

Neurospora-Sar1 ------------------------------------------------------------

Drosophila-Sar1 ------------------------------------------------------------

Ostreo-Sar1 ------------------------------------------------------------

Physco-Sar1 ------------------------------------------------------------

Ara-Sar1 ------------------------------------------------------------

Oryza-Sar1 ------------------------------------------------------------

Ara-OBGL --ATTYTRLPPREDYYDVSLLSSSYLKVSEEVKLSESNVARVEEKIETLREIEEEEKEKE

Vitis-OBGL --ATTYTSLPPREDFFTTSLNSS--FQSSTEIKLSDLSPPTIESEIDKSSHEEDVFDEQL

Oryza-OBGL RGATTFARLPLRDSPDGGDLTIG-HFDAGVAPQEGLRSRAISRQLVEHLDDVEEEEEEQV

Popu-OBGL ------------------------------------------------------------

Physco-OBGL ------------------------------------------------------------

Chlamy-OBGL ------------------------------------------------------------

Ostreo-OBGL --AKTNDWASSLAAYREEAASKE--RQRSEMG-AELAAMERVETARDDLIDTVWVNDAGS

Syne-OBGL ------------------------------------------------------------

Synec-OBGL ------------------------------------------------------------

Nostoc-OBGL ------------------------------------------------------------

Bacil-OBGL ------------------------------------------------------------

Sphaero-OBGL ------------------------------------------------------------

Chloro-OBGL ------------------------------------------------------------

Listeria-OBGL ------------------------------------------------------------

Clost-OBGL ------------------------------------------------------------

Saccharomyces-Sar1 ------------------------------------------------------------

Neurospora-Sar1 ------------------------------------------------------------

Drosophila-Sar1 ------------------------------------------------------------

Ostreo-Sar1 ------------------------------------------------------------

Physco-Sar1 ------------------------------------------------------------

Ara-Sar1 ------------------------------------------------------------

Oryza-Sar1 ------------------------------------------------------------

Ara-OBGL VKSYDDDDIWGNYRRLDVFEGSSRSID------------EDDEDWEDEVFEYG-------

Vitis-OBGL GFDY------GKFELYEVNSDPEEEDE------------DEDEDGEGQVFVG--------

Oryza-OBGL VSRLDIFEGAKGREARAFLPDEDDEDDDVVVFDPEYDGYSDDEEFVATAVEQSPRGDAIA

Popu-OBGL ------------------------------------------------------------

Physco-OBGL ------------------------------------------------------------

Chlamy-OBGL ------------------------------------------------------------

Ostreo-OBGL VARKEFKGLQAGEDAATFGDDEADFID---------FGGDDDDVWDPSEGGFG-------

Syne-OBGL ------------------------------------------------------------

Synec-OBGL ------------------------------------------------------------

Nostoc-OBGL ------------------------------------------------------------

Bacil-OBGL ------------------------------------------------------------

Sphaero-OBGL ------------------------------------------------------------

Chloro-OBGL ------------------------------------------------------------

Listeria-OBGL ------------------------------------------------------------

Clost-OBGL ------------------------------------------------------------

Saccharomyces-Sar1 ------------------------------------------------------------

Neurospora-Sar1 ------------------------------------------------------------

Drosophila-Sar1 ------------------------------------------------------------

Ostreo-Sar1 ------------------------------------------------------------

Physco-Sar1 ------------------------------------------------------------

Ara-Sar1 ------------------------------------------------------------

Oryza-Sar1 ------------------------------------------------------------

Ara-OBGL ------------DETDAEKDDSEGSELKDGEVLCFSGEEEEDEIGVKEKGVPAVMRCFDR

Vitis-OBGL ---------------------------HGEMVSVFNGEEEE-----KEKGLPAVMRCFDR

Oryza-OBGL VAELEKLKYDNDDDDDDDDEVVVFHPDDDEEVDVFEDYDDDEEEETKEKGVPAVMRCFDT

Popu-OBGL ------------------------------------------------------MRCFDR

Physco-OBGL ------------------------------------------------------MRCFDR

Chlamy-OBGL ------------------------------------------------------MRCFDT

Ostreo-OBGL ------------------------------KFIEVGDDDIFEPREEKSRGIPREMRCFDT

Syne-OBGL ------------------------------------------------------MQFIDQ

Synec-OBGL ------------------------------------------------------MHFIDQ

Nostoc-OBGL ------------------------------------------------------MQFIDQ

Bacil-OBGL -------------------------------------------------------MFVDQ

Sphaero-OBGL -------------------------------------------------------MFYDR

Chloro-OBGL --------------------------------------------------MATGTDFFDQ

Listeria-OBGL -------------------------------------------------------MFVDQ

Clost-OBGL -------------------------------------------------------MFRDS

Saccharomyces-Sar1 ------------------------------------------------------------

Neurospora-Sar1 ------------------------------------------------------------

Drosophila-Sar1 ------------------------------------------------------------

Ostreo-Sar1 ------------------------------------------------------------

Physco-Sar1 ------------------------------------------------------------

Ara-Sar1 ------------------------------------------------------------

Oryza-Sar1 ------------------------------------------------------------
Ara-OBGL AKIYVRAGDGGNGVVAFRREKFVPFGGPSGGDGGRGGNVYVEVDGSMNSLLPFRKSVHFR

Vitis-OBGL AKIYVKAGDGGNGVVAFRREKYVPFGGPSGGDGGRGGNVYVEVDGSMNSLLPFRNGVHFR

Oryza-OBGL AKIYAKAGDGGNGVVAFRREKYVPLGGPSGGDGGRGGNVFVEVDGDMNSLLPFRKSVHFR

Popu-OBGL AKIYVKAGDGGNGVVAFRREKFVPLGGPSGGDGGRGGNVYLEVDGSINSLLPFRNRVHYR

Physco-OBGL AKIYVKAGDGGNGVVAFRREKYVPFGGPSGGSGGRGGDIYIEADTAMNSLLPFRKQVHFR

Chlamy-OBGL ARIYLKGGDGGNGCVAFRREKFVEHGGPSGGNGGRGGNVWAVVDPNLNSLSVFRGQVHFR

Ostreo-OBGL AKIFVKAGDGGDGQVAFRREKFVPQGGPSGGNGGLGGGIYFVGDKNINSLDIFRKKVHHR

Syne-OBGL AEIEVQGGKGGDGMVSFRREKYVPAGGPSGGNGGRGGSVIFEADANLQTLLDFRYARIFK

Synec-OBGL AEIEVQGGNGGDGIVAFRREKYVPAGGPSGGNGGRGGSVILVADPGLQTLLDFRFQPVIK

Nostoc-OBGL AKIEVEAGKGGDGIVAFRREKYVPTGGPSGGNGGRGGSVFFVADENLQTLLDFRYNHRFQ

Bacil-OBGL VKVYVKGGDGGNGMVAFRREKYVPKGGPAGGDGGKGGDVVFEVDEGLRTLMDFRYKKHFK

Sphaero-OBGL AKIYVKAGDGGNGAISFRREKYVPFGGPDGGDGGDGGDVYLRVDPHLNTLIAFKYKQHFR

Chloro-OBGL ATIVVRAGNGGNGAATFRREKYVPRGGPNGGDGGRGGHVYLIADPEYNTLLHFRYQRKFV

Listeria-OBGL VKIYVKAGNGGDGMVAFRREKFVPNGGPAGGDGGKGADVVFVVDEGLRTLVDFRFKRIFK

Clost-OBGL AKIYVKAGNGGNGMVSFHREKYIAAGGPDGGDGGKGGDVIFVVDEGLNTLIDFRYKKNFK

Saccharomyces-Sar1 ------------------------------------------------------------

Neurospora-Sar1 ------------------------------------------------------------

Drosophila-Sar1 ------------------------------------------------------------

Ostreo-Sar1 ------------------------------------------------------------

Physco-Sar1 ------------------------------------------------------------

Ara-Sar1 ------------------------------------------------------------

Oryza-Sar1 ------------------------------------------------------------

Ara-OBGL AGRGEHGRGKMQSGAKGDNVVVKVAPGTVVRQAREVGSEVEGEEG-EEKEVLLELLHPGQ

Vitis-OBGL AGRGSHGQGRNQNGAKGEDVVVKVAPGTVIREA--------GSDG-VEGEVLLELLHPGQ

Oryza-OBGL AGRGAHGQGRQQAGAKGDDVVVKVPPGTVVRSA--------AGD-----VELLELMRPGQ

Popu-OBGL AGRGSHGQGSCMGGAKGEEIVVKVPPGTVVREA--------GNE-----EVLLELLSPGQ

Physco-OBGL ADRGAHGKGSSREGANGPDCVVKVPVGTVIRAAE-------GQDVGSEREILLELTKPGQ

Chlamy-OBGL AEGGVNGQGSNCEGADAEDLIVPVPAGTIIRRK--------DAEE--DEPPLAELLKPGE

Ostreo-OBGL AEGGKRGLGDKMAGRNGRDLEILVPPGTIIR----------DSR---TQKIIGEITKGGQ

Syne-OBGL AEDGKKGGSSNCTGANGKDVVVQVPCGTMVYDL--------DGEC-----LLGDLVSPGQ

Synec-OBGL AEHGAKGGPNHRSGASGADRLVRVPCGTVVFNA--------ETGE-----LLGDLVGKGD

Nostoc-OBGL AEKGTRGGPNNCTGAGGKDLIIEVPCGTTIYDA--------ETGE-----LLGDLTEPQQ

Bacil-OBGL AIRGEHGMSKNQHGRNADDMVIKVPPGTVVTDD--------DTKQ-----VIADLTEHGQ

Sphaero-OBGL AERGESGQGAKKTGKRGAHLYIDVPPGTVVMDD--------ETGR-----VLADLVHPGE

Chloro-OBGL AENGGHGGKNAMHGRNGADVYVPVPPGTVVRAT--------INGVT----YTVDLARPGQ

Listeria-OBGL AEHGDHGMSKSMHGRGAEDLVVKVPQGTIVKDI--------DTGE-----IIADLVAHGQ

Clost-OBGL AEPGQDGGTSNRSGKNGEDLIIKVPLGTVVKDE--------LTDM-----VLVDLIKPGQ

Saccharomyces-Sar1 ------------------------------------------------------------

Neurospora-Sar1 ------------------------------------------------------------

Drosophila-Sar1 ------------------------------------------------------------

Ostreo-Sar1 ------------------------------------------------------------

Physco-Sar1 ------------------------------------------------------------

Ara-Sar1 ------------------------------------------------------------

Oryza-Sar1 ------------------------------------------------------------

Ara-OBGL RALLLPGGRGGRGNASFKSGMNKVPRIAENGEEGPEMWLDLELKLVADVGIVGAPNAGKS

Vitis-OBGL RAMLLPGGRGGRGNASFKSGTNKVPKIAENGEEGPEMWLELELKLVADVGIVGAPNAGKS

Oryza-OBGL RALLLPGGRGGRGNAAFKSGTNKAPRIAEKGEKGPEMWIDLELKLVADVGIVGAPNAGKS

Popu-OBGL RALVLPGGRGGRGNAAFKCGSNKVPRIAENGEEGSEMWLELELKLVADVGIVGAPNAGKS

Physco-OBGL KELLLPGGRGGRGNAAFKTGRNKAPQLAEYGEVGAEMWIELELKLVADVGIVGVPNAGKS

Chlamy-OBGL KALLAVGGRGGRGNFSFKTSRDRAPTIAEKGEKGEELWVDLELKVVADAGIIGVPNAGKS

Ostreo-OBGL RVLALVGGRGGRGNASFKTAKNKAPMIAELGEKGKEFWAELELKLVADVGIIGVPNAGKS

Syne-OBGL RLCVAAGGKGGLGNQHFLSNRNRAPEYALPGLEGEQRQLRLELKLLAEVGIIGLPNAGKS

Synec-OBGL QLLVARGGKGGLGNAHFLSNHNRAPRQFTKGEAGERVRLRLELKLIAEVGIVGLPNAGKS

Nostoc-OBGL TLLIAQGGKGGLGNQHFLSNRNRAPEYALPGLPGEIKQLRLELKLLAEVGIIGLPNAGKS

Bacil-OBGL RAVIARGGRGGRGNSRFATPANPAPQLSENGEPGKERYIVLELKVLADVGLVGFPSVGKS

Sphaero-OBGL VVRVARGGKGGLGNARFATATRQAPRMAEKGEPGEERWIRLEMKLIADVGLVGLPNAGKS

Chloro-OBGL RLLAARGGRGGLGNIHFTTPTRQAPRLAELGEPGQELTLELELKMLADVGLVGFPNAGKS

Listeria-OBGL RAVIAKAGRGGRGNKRFATPANPAPELSENGEPGQERNVQLELKVLADVGLVGFPSVGKS

Clost-OBGL TCVIAKGGRGGKGNQHFATPTRQVPNFAKSGDLGEEYSLILEMKMIADVGLVGYPNVGKS

Saccharomyces-Sar1 -------------MAGWDIFGWFRDVLASLGLWNKH----------GKLLFLGLDNAGKT

Neurospora-Sar1 ----------------MWLWSWFYDILSNLGLLNKH----------GKLLFLGLDNAGKT

Drosophila-Sar1 ----------------MFIWDWFTGVLGYLGLWKKS----------GKLLFLGLDNAGKT

Ostreo-Sar1 ---------------MVFILDWFYDVLASLGLWQKN----------AKILFLGLDNAGKT

Physco-Sar1 ----------------MFLFDWFYSVLATLGLWQKE----------AKILFLGLDNAGKT

Ara-Sar1 ----------------MFMIDWFYGVLASLGLWQKE----------AKILFLGLDNAGKT

Oryza-Sar1 ----------------MFLWDWFYGVLASLGLWQKE----------AKILFLGLDNAGKT

Ara-OBGL TLLSVISAAQPTIANYPFTTLLPNLGVVSFDY--DSTMVVADLPGLLEGAHRGFGLGHEF

Vitis-OBGL TLLSVISAAQPTIANYPFTTLLPNLGVVSFGY--DATMVVADLPGLLEGAHKGFGLGHEF

Oryza-OBGL TLLTAISAAKPTIANYPFTTLLPNLGVVSLDF--DATMVVADLPGLLEGAHRGYGLGHEF

Popu-OBGL TLLSVISAAQPAIANYPFTTLLPNLGVVSFDY--DSTMVVADLPGLLEGAHRGFGLGHEF

Physco-OBGL TLLSAISAAKPTVANYPFTTLLPNLGVVPIGY--DASMVVADLPGLLEGAHQGIGLGHEF

Chlamy-OBGL TLLSVITAARPKIANYPFTTLVPNLGVCEMDY--ST-TVFADVPGLLEGAHEGLGLGHEF

Ostreo-OBGL TLLASVSAAKPKIADYPFTTIVPNLGVVDRDY--ER-MVFADIPGILEGASEGVGLGFEF

Syne-OBGL TLIAALSAARPKIADYPFTTLVPNLGVVRKPT--GDGTVFADIPGLIEGAAAGIGLGHEF

Synec-OBGL TLISVVSSARPKIADYPFTTLQPNLGVVPHPS--GDGVVFADIPGLIEGAHLGVGLGHEF

Nostoc-OBGL TLISSLSAARPKIADYPFTTLIPNLGVVRKPT--GDGTVFADIPGLIAGASHGAGLGHDF

Bacil-OBGL TLLSVVSSAKPKIADYHFTTLVPNLGMVETDD--GRSFVMADLPGLIEGAHQGVGLGHQF

Sphaero-OBGL TLLAASSSARPKIADYPFTTITPMLGVVEIGGPGGETFVMADIPGLIEGAAEGVGLGHEF

Chloro-OBGL TLLSVISAARPKIAAYPFTTLTPNLGIVEVG---VQRFVVADIPGLIEGAHAGVGLGHDF

Listeria-OBGL TLLSVVSAARPKIAAYHFTTIVPNLGMVDAGD--GRSFVMADLPGLIEGASQGVGLGHQF

Clost-OBGL TILSMVSAAKPKIANYHFTTLVPNLGVVQIEH--GKSFVIADIPGLIEGAHEGVGLGHQF

Saccharomyces-Sar1 TLLHMLKNDRLATLQPTWHPTSEELAIGNIK------FTTFDLG----GHIQARRLWKDY

Neurospora-Sar1 TLLHMLKNDRVAILQPTLHPTSEELSVGNVK------FTTFDLG----GHQQARRLWKDY

Drosophila-Sar1 TLLHMLKDDKLAQHVPTLHPTSEELSIGNMR------FTTFDLG----GHTQARRVWKDY

Ostreo-Sar1 TLMHMLKDERLAQHQPTQYPTSEELSIGQIR------FKAFDLG----GHEVARRVWKDY

Physco-Sar1 TLLHMLKDERLAQHQPTQYPTSEELSIGKIK------FKAFDLG----GHQIARRVWKDY

Ara-Sar1 TLLHMLKDERLVQHQPTQHPTSEELSIGKIK------FKAFDLG----GHQIARRVWKDY

Oryza-Sar1 TLLHMLKDERLVQHQPTQHPTSEELSIGKIK------FKAFDLG----GHQIARRVWKDY

Ara-OBGL LRHTERCSALVHVVDGSA----PQPELEFEAVRLELELFS--PEIAEKPYVVAYNKMDLP

Vitis-OBGL LRHTERCSSLVHVVDGSS----QQPEYEFDAVRLELELFS--PELAEKPYVVAYNKMDLP

Oryza-OBGL LRHSERCSVLVHVVDGSG----EQPEYEFEAVRLELELFS--PSLVDKPYIVVYNKMDLP

Popu-OBGL LRHTERCSALVHVVDGSS----QQPEFEFDAVRLELEMFS--PELAEKPYVVAYNKMDLP

Physco-OBGL LRHTERCSVLVQVVDGTC----TQAFEEYEAIRLELQLFN--PELAEKPFVVAYNKMDTQ

Chlamy-OBGL LRHVQRCRVLVHVVDGTS----PDPVGDFNAINLELELFN--PDLKDKPQLVAYNKVDIP

Ostreo-OBGL LRHTKRTRVLVHVIDCTS----ETCLEAYEAIRTELELFD--AVLLDKPEIVALNKVDDV

Syne-OBGL LRHIERTRLLLHVLDVTA----GDPIANFRVIQQELDAYG--RGITEKPQIIALNKIDAL

Synec-OBGL LRHVERTRVLIHLVDGTA----ADPVKDYQVIQQELRAYG--HGLIDKPQILVLNKIDVL

Nostoc-OBGL LRHIERTRVLLHLIDATS----DDVIRDYNTIKEELQAYG--QGLAERPQILALNKIDAV

Bacil-OBGL LRHIERTRVIVHVIDMSG-LEGRDPYDDYLTINQELSEYN--LRLTERPQIIVANKMDMP

Sphaero-OBGL LRHIERTRLLIHVLDGSGGLEGRDPLEDFRTINEELAAYA--PELAERPQIVAINKIDLP

Chloro-OBGL LRHIERTRLLIHIIDAAG-VDGRTPWDDYEQINTELRLYQ--PELAQRKQVVALNKADLP

Listeria-OBGL LRHIERTRVIVHVIDMSG-SEGRVPYEDYMAINNELEQYN--LRLMERPQIIVANKMDMP

Clost-OBGL LRHVERTKLLVHVVDVSG-VEGRDAVEDFDTINSELQKYN--QVLSTRPQIVAANKMDIP

Saccharomyces-Sar1 FPEVNGIVFLVDAADPER----------FDEARVELDALFNIAELKDVPFVILGNKIDAP

Neurospora-Sar1 FPEVNGIVFLVDAKDHER----------LPEAKAEIDALLSMEELAKVPFVVLGNKIDHP

Drosophila-Sar1 FPAVDAIVFLIDAWDRGR----------FQESKNELDSLLTDEALSNCPVLILGNKIDKP

Ostreo-Sar1 YAKVDAIVFLVDAVDKER----------FMESKKELDSLLGDDSLGSVPFLILGNKIDIP

Physco-Sar1 YAKVDGIVYLVDAADKER----------FSESKKELDALLSDDSLGQVPFLVLGNKIDIP

Ara-Sar1 YAKVDAVVYLVDAYDKER----------FAESKKELDALLSDESLASVPFLILGNKIDIP

Oryza-Sar1 YAKVDAVVYLVDAYDKER----------FAESKKELDALLSDDSLATVPFLILGNKIDIP

Ara-OBGL DAYEKW--PMFQETLRAR-GIEP---FCMSAVQREGTHEVISSVYELLKKYRAANAEPKA

Vitis-OBGL EAYERW--PSFKERLQAR-GIGT---FCMSAVKGEGTHEVVCAAYELLRNRTESNKEIEG

Oryza-OBGL EASERW--NKFQEKLQAE-GIEP---YCISAMNRQGTEDVVLAAYKVLQKDRQRMKDDEE

Popu-OBGL EAYENW--QLFKEKLEAR-GIET---FCMSAVKREGTHEVICAAHKLLQESKEANKGSEG

Physco-OBGL EAVDQW--PSFQESLEKQ-GIKA---FPMSAATQEGTMAVVYQAYELLESRKRASLDEEK

Chlamy-OBGL DSGDFW--EMVREQLTTELGVPADRIFPISAATGQGVIELVRAVRGVLDELGPQQLTYET

Ostreo-OBGL EATERA--LQMKEMFDAQ-GVTS-H--CISAVTGEGVEELLGDVQAALRALPPVEDEWEA

Syne-OBGL DGEMIG--EIETELKRFS-TAPC---LHISAATRRGLDDLMQLVWQWLDE----------

Synec-OBGL DPQQVA--ERAQRLSAAA-GTSV---VTISAIAKQGLDPLLQRVWQCLGR----------

Nostoc-OBGL DRETVDLEALATQLNHLS-YAPV---FIISAVTRTGLEPMLQEIWGILDQ----------

Bacil-OBGL EAAENL--EAFKEKLTDD--YPV---FPISAVTREGLRELLFEVANQLENTPEFPLYDE-

Sphaero-OBGL ETQANL--PRLTEALTRE-GYEV---FPISAATTEGVPALLARVLERLRELPSPQ--VVA

Chloro-OBGL AAQANL--PILRERLPVA-PEDL---FVISAATRAGIEPLLQRVAELLRADPPPQRDPVD

Listeria-OBGL DAEENL--KEFKTKIAED--IPV---FPISAVTKTGLRELLLAIADKLETTPEFPLNEIL

Clost-OBGL GAEENY--KAFKEELEKR-GYKV---FGISAATNKGLKELLYAVSETLKTLPDTILLDET

Saccharomyces-Sar1 NAVSEA--E-LRSALGLL---------N---TTGSQRI----EGQRPVEVFMCS------

Neurospora-Sar1 EAVSED--E-LRQRLGLW---------Q---TTGKGRVPL--EGIRPIEVFMCS------

Drosophila-Sar1 GAASED--E-LRNVFGLY---------QL--TTGKGKVARADLPGRPLELFMCS------

Ostreo-Sar1 HAASEE--E-LRHCLGLT---------NY--TTGKGKVNLENTNMRPIEVFMCS------

Physco-Sar1 YAVSED--E-LRYSLGLS---------NF--TTGKGKVNLGDTNMRPIEVFMCS------

Ara-Sar1 YAASED--E-LRYHLGLS---------NF--TTGKGKVNLTDSNVRPLEVFMCS------

Oryza-Sar1 YAASEE--E-LRYHLGLS---------NF--TTGKGKVSLGESNVRPLEVFMCS------

Ara-OBGL LFDQANENLDHVAKKIDKERRAAINEFEVFRDSGT--------RAWHVVGAGLQRFVQMT

Vitis-OBGL WTDPV--NLNHVADMLHKQRSASINEFEIFHEKGS--------NTWHVVGSGLQRFVQMT

Oryza-OBGL WNGPE--NLNHVADAIKRERRAPMNEFEIFHDKGT--------NTWNVVGAGIERFVQMT

Popu-OBGL WTHPI--NLNHVADMVQRQRRAPINDFEISYDNAS--------KTWQVVGAGLQRFVQMT

Physco-OBGL VNEDT----EQVGDVVKKIRDAPIEKYEIISDKRT--------RTWEVKGAGLDRFTQMT

Chlamy-OBGL NALNQ---------TAVQRREVRIDDFTVAMEDLPPGSASTAPRVFYVEGEGIERFAQMT

Ostreo-OBGL EVAET---------GKRAADGKSIEEF--EIEDTP---Y-----AFIVRGDAIERFTQMT

Syne-OBGL ----------------------------------------------------------MA

Synec-OBGL ----------------------------------------------------------GS

Nostoc-OBGL ----------------------------------------------------------MK

Bacil-OBGL EELTQ--------NRVMYTMENEEVPFNITRDPDG---------VFVLSGDSLERLFKMT

Sphaero-OBGL PQER----------RVYTLEETQEDWWEAERISRH---------HFVVRGPKIERITRMT

Chloro-OBGL PDEPP---------LEWPLPPVDENAFTVEREG-D---------AFRVRGVKIERLIAMS

Listeria-OBGL EQEDE--------DTVLYKYVAEEPDFEITREPDG---------TFVLSGAKIERLFTMT

Clost-OBGL QNEE-----------VVYKVQ-EEKPFEIHIE-DG---------VYVIEGKWLRKVLGST

Saccharomyces-Sar1 --------------------------------------------------------VVMR

Neurospora-Sar1 --------------------------------------------------------VVMR

Drosophila-Sar1 --------------------------------------------------------VLKR

Ostreo-Sar1 --------------------------------------------------------VVRR

Physco-Sar1 --------------------------------------------------------IVRK

Ara-Sar1 --------------------------------------------------------IVRK

Oryza-Sar1 --------------------------------------------------------VVRK

Ara-OBGL NWRYMDSDKRFQHVLDACGVNKSLKNMGVKEGDTVIVGEMELIWHDSANGSSRPTDSNKT

Vitis-OBGL NWRYIESDRRFQHVLEACGVNKSLIKLGVKEGDTVIVGEMEMVWHDSAD-SSGPSNVRKE

Oryza-OBGL NWQYSESLKRFQHALEACGVNKTLIKRGVKEGDTVVVGEMEMVWTDEPS-KTRSSKTMNS

Popu-OBGL NWRYKDSDTRFQHVLEACGVNKSLLKMGVKEGDTVIVGEMEMVWHDYPQ-SSGLSKVT--

Physco-OBGL NWEYFESVRRFQHVLIASGVNRSLREQGVKEGDTVIVGQVIPVHLPEFFLHALHQLVD--

Chlamy-OBGL NWDYYEAVKRFQRVLEVSGINGALKARGVRQGDSVVIGETEFSWSDD-------------

Ostreo-OBGL NWDYYESYKRFARVLEMAGIDRALDAAGAGEGDRILVGDYEFEWSKDRRDRTLYESFRQR

Syne-OBGL A-ADAEAQRLLELELQAQAAMNNPFNSDVPIDGVTYSS----------------------

Synec-OBGL Q-QPAQLDLVGAKSIQS-------------------------------------------

Nostoc-OBGL VPEEVEALR---------------------------------------------------

Bacil-OBGL DFSRDESVKRFARQMRGMGVDEALRERGAKDGDIIRLLEFEFEFID--------------

Sphaero-OBGL DFGNEEAAERYQRVLEASGISAKLEELGIQPGDVVHVADVELIWDEAALEAERQEAAAQR

Chloro-OBGL NLEQDEAIDRIQRVLEASGINEALMAAGVQDGDVVRIGRAELVWDDSGQHAL--------

Listeria-OBGL NFERDASISRFARQLRAMGVDEALRKRGAKDGDIVRLLDYEFEFMD--------------

Clost-OBGL NITNYESLQYFQRALKKKGVITALEEMGIQEGDTVRIYDTEFDYTR--------------

Saccharomyces-Sar1 N-GYLEAFQWLSQYI---------------------------------------------

Neurospora-Sar1 Q-GYGEAIRWLSQYV---------------------------------------------

Drosophila-Sar1 Q-GYGEGFRWLAQYID--------------------------------------------

Ostreo-Sar1 M-GYAEGFRWVSQYI---------------------------------------------

Physco-Sar1 M-GYGEGIKWMSQYIK--------------------------------------------

Ara-Sar1 M-GYGEGFKWVSQYIK--------------------------------------------

Oryza-Sar1 M-GYGDGFKWVSQYIK--------------------------------------------

Ara-OBGL STDSV-------RWPQWK-----

Vitis-OBGL STDSV-------KWPQWK-----

Oryza-OBGL KDDSV-------RWPEFG-----

Popu-OBGL ------------KWPEWK-----

Physco-OBGL --------------SLL------

Chlamy-OBGL -----------------------

Ostreo-OBGL QADLPGAARGSRHWPHAA-----

Syne-OBGL -----------------------

Synec-OBGL -----------------------

Nostoc-OBGL -----------------------

Bacil-OBGL -----------------------

Sphaero-OBGL RRKTRRERMAARLGIDPDELLER

Chloro-OBGL -----------------------

Listeria-OBGL -----------------------

Clost-OBGL -----------------------

Saccharomyces-Sar1 -----------------------

Neurospora-Sar1 -----------------------

Drosophila-Sar1 -----------------------

Ostreo-Sar1 -----------------------

Physco-Sar1 -----------------------



Ara-Sar1 -----------------------

Oryza-Sar1 -----------------------


База данных защищена авторским правом ©shkola.of.by 2016
звярнуцца да адміністрацыі

    Галоўная старонка