Additional file 1




старонка1/14
Дата канвертавання19.04.2016
Памер1.09 Mb.
  1   2   3   4   5   6   7   8   9   ...   14
Additional file 1 (additional file 1.doc) List of prepropeptides. List of prepropeptides from 24 apterygote hexapod species (Protura, Diplura, Collembola, Archaeognatha, Zygentoma), 2 crustacean species and 3 myriapod species; these data are deduced from transcriptome sequence assemblies obtained from the 1KITE project. The majority of prepropeptides contain neuropeptides with known receptors in insects; receptors are not known for the products of the elevenin, efl-amide, and orcokinin genes. In addition, currently available and critically revised sequences from the well-studied water flea Daphnia pulex (Branchiopoda) and fruit fly Drosophila melanogaster (Diptera) are listed. The genomes of these species were repeatedly screened for neuropeptide genes. Predicted signal peptides (highlighted in grey), amidation signals (bold), cleavage signals (italics, bold), splice variants (a, b), and supposed bioactive mature peptides (underscored) are indicated. Incomplete sequences are indicated with "…". In some cases, sequences were reconstructed through the fusion of different database entries, or by including sequences from 3'-UTR regions encoding putative coding exons of a different splice form (see ITP). For a few Thermobia sequences, PCR and RACE experiments were conducted (Derst C, Bläser M, Predel R; unpublished results) to obtain full-length sequences; this information is given subsequent to accession or JGI numbers.
Adipokinetic hormone corazonin-like peptide (ACP)
>Nipponentomon nippon (Protura) ACP1

SLSSSSQIVLVSFLTASLFISCWCFNSAAGQVTFSRDWSAGKRSTYPSHRCQPGRDLLSAVRQLIMHEARKMRNCDMITSMTLEPEEAVGRKTQPWRRGADDKTEIPGEDGNSGFVVRNEDQHGPSTP*


>Nipponentomon nippon (Protura) ACP2

MSQVKNCHWTIILVSLGGIGLFLIHQASSQVTFSRDWSAGKRSSSIVSPPKCHGDQGLLAAVKQLILHEARRMVDCDRLASLRGQQEYEEVRRGDDRMDAGPPEIPTTIDDALSSGFVIRQPKQDRNAP*
>Acerentomon sp. (Protura) ACP1 [GenBank:GAXE01015046.1]

STYSARGVILVTGATVCVIICSCFNLCSAQVTFSRDWSAGKRSSYLPHRCQPSADLVTAVRQLIMHEARKMSNCNTISLNLEEEAIARKRDLPRRQPDDKQDSEIPTLDEVVNSGFVIHRGNDENGQRGTAR*


>Acerentomon sp. (Protura) ACP2 [GenBank:GAXE01015047.1]

STYSARGVILVTGATVCVIICSCFNLCAAQVTFSRDWSAGKRSSYLPHRCQPSADLVTAVRQLIMHEARKMSNCNTISLNLEEEAIARKRDLPRRQPDDKQDSEIPTLDEVVNSGFVIHRGNDENGQRGTAR*
>Filientomon takanawanum (Protura) ACP

MMPVRSTLSYLLQVGLVSLLTASLLMSCWCVHSAAGQVTFSRDWSAGKRSASPSHRCQPGKDLVNAVRQLIMHEARKMRNCDMLTSMTLEPEDPSGRKTQPWRRGADDKTEVAIEDGNSGFIVGTLSDDNHQGPSLP*
>Anurida maritima (Collembola) ACP [GenBank:GAUE01039625.1]

MFRLLSVFLIIQLSLIMTFAQITFTREWTGGKRSAPTSPAVRRGNCVSFMPTINFLMQ…
>Tetrodontophora bielanensis (Collembola)ACP [GenBank:GAXI01057634.1]

MKQFFFIFLIIQTTFLITLAQITFTREWVTGKRSSGVPSRLIIKENTRGQKLLPAIEYLMKNENLKKVGYGYTD…
>Podura aquatica (Collembola) ACP

FSNAQITFSREWVGGKRSAPISAFNSNLAHHAAEGCMSFMHTIQFLLKIE*


>Folsomia candida (Collembola) ACP [GenBank:GASX01085389.1]

MKYIFSIFLVVQLSLFAASMAQITFTREWVTGKRSAAPKLRVLMHDDNICKSLLPAIDYLLEVEKIHQKLCGPPPKSYSVPVMLKKLTPVSDVLSSSSSGDQGYDDGYDGVASSHMQKST*
>Orchesella cincta (Collembola) ACP

MKAVVCFLLFFYFASSIAQITFTREWVKGKRSTTANTAAAAKDGHSVCQNLVTAVEYLIELEKLRRAECLECCHSAPPAFPDLPDIQRSPSDFMQFFRKLPPVEQEQMVRVVPSQESRNQ*
>Pogonognathellus sp. (Collembola) ACP [GenBank:GATD01025898.1]

ITFTREWVTGKRSLPPTRKVIVKEEHAWCSRSFVPVIEYLVEEERVRKHECGSHLNVNIPKSVSWIRPAIIDELP…


>Sminthurus viridis (Collembola) ACP [GenBank:GATZ01092399.1]

MRSLICILLAIQLSISLVVAQITFTREWVNGKRNSPSSIFTPQNSQDYLPCKSLWPAIEILMETERLQQAHCGIRLRPAKYMAHFKDPLTGAINKLQDEESVQFEED…
>Campodea augens (Diplura) ACP [GenBank:GAYN01117863.1]

FFCVLCLRSYTADAQVTFSRDWQAGKRSSDFSDSCEVPHMAFFKSIRRLIGTESSRIASCKMQLFINGFPSLSNDVIEAAHALMKTNDGAQS*


>Lepidocampa weberi (Diplura) ACP

MISSHHIMIISFVLIFTISVFHTANAQVTFSRDWQAGKRSLETGENCEIPKLAFFKAVRRLLGSESSRMAACKMQAFLTDIPSLNNDDVIDSAHSLMKVHPDRQP*
>Pedetontus okajimae (Archaeognatha) ACP

MALYRINTFLVTVCIAATLLGLAFQETASQVTFSRDWTAGKRSPITSSELTSSCNLLLREVQKLAKAEIRRITSCEMKSFLKGDKKLESVSDLVEDDLDTIYSARTRR*
>Machilis hrabei (Archaeognatha) ACP [GenBank:GAUM01120457.1]

HETSSQVTFSRDWTAGKRASLSPNQLTSSCNMLLHEVQRLAKAEIRRMTSCEMKTLLKGDKKFDGITDLVEDDLETIYSTRTR…


>Meinertellus cundinamarcensis (Archaeognatha) ACP [GenBank:GAUG01190983.1]

MSLSYRLNSALVTICVFVTILSLVCHQTSAQVTFSRDWTAGKRSSTGISALPSSCKLLLREVHKLAIAEIRRQS…
>Machilontus sp. (Archaeognatha) ACP

RLAACESKLTFKGDKIVDAADLSEDDLESAAAYQSHARR*


>Tricholepidion gertschi (Zygentoma) ACP [GenBank:GASO01199980.1]

FCVVAAFLVLSVIYKVDAQVTFSRDWTAGKRSASDLDCNVLVKSALVKLQKLVTNELRLVSACEMGSLIHAVKGGDRLNMLEYRDESLDTPGYIPANQN…
>Thermobia domestica (Zygentoma) ACP [GenBank:GASN01384281.1]

SPIVLLVIICIYGSADGQVTFSRDWTAGKRSALNERGECFADARAVLHRVEKILTNEFREMAGCEVRSLLRASEGGPKINPAEFPPPVEELENTGLFSQHSRR*
>Atelura formicaria (Zygentoma) ACP1 [GenBank:GAYJ01000651.1]

MSMTPRLSLSIFFLGLLLVVMSCMSHSADAQVTFSRDWTAGKRSLGGQEECASDLRAVLVKIQRLITNELRQMYACVLKSPLNKAGDRVKLEFAEGGVGDLEGSAFFPAPSRR*
>Atelura formicaria (Zygentoma) ACP2 [GenBank:GAYJ01000652.1]

MSMTPRLSLSIFFLGLLLVVMSCMSHSADAQVTFSRDWTAGKRSLGGQEECASDLRAVLIKIQRLVTNELRQMYACVLKSPLNKGGDRVKLEFAEGGVGDLEGSAFFPAPSRR*
>Nicoletia phytophila (Zygentoma) ACP

MVTRFSLRMPVSCVLVAILLPCTFLCSDAQVTFSRDWTAGKRSEGGEVSGCLSVLRPVLGKIQRIVTDELRHIAACEVKSLLHKEGDKLKVEYHDTGVEDLDNSAFYPVATRR*

..............................................................................................


>Xibalbanus tulumensis (Remipedia)ACP [GenBank:JL122470.1](Christie 2014)

MNQRLDRVYPAVMGSFLISLVLLSAFTQMTVAQVTFSRDWNAGKRSGAAALYPDCAMPERALLSEVSKLIHNEAQRMVSCQAWTVLRG*
>Hanseniella sp. (Symphyla) ACP

SRGQVTFSKDWKAGKRAVTEGCSINTIYLVRRLHRIVKTELDHLEDCGYGSMIEDLPRFE*


>Eudigraphis takakuwai nigricans (Diplopoda) ACP1

MVAIRSIPTLVMLVALCSLPLLAHSQVTFSRDWSAAGKRASVVTDCHAAVTRLLPQMAYVGEVCSPHQAVEPAFATRK*
>Eudigraphis takakuwai nigricans (Diplopoda) ACP2

MAKLHCPVLAVALLFVTLLLLLAPSTGQLTFSRGWLPSGKRSGDCHAALARLMPDLSYLSEVCNLRPYDDM*

..............................................................................................


no ACP known from D. melanogaster and D. pulex

Adipokinetic hormone (AKH)
>Nipponentomon nippon (Protura) AKH1

MNFASHRSLLVLLVVVLGHLCLIHGQVNFSPSWGKRGPPANPAQEQPGPNVCKTSMDALMNLYRIIQAEAQRLRDCQQFER*
>Nipponentomon nippon (Protura) AKH2

MSPSMSRCLMVLFAIVLVHLCVIQGQVNFSPSWGKRGPPSNAVQDGNPNACKTSMDTLMNLYRIIQAEAQRLRECQQFER*
>Acerentomon sp. (Protura) AKH [GenBank:GAXE01132055.1]

MSPSTPRSLLVVLALVLAHICLIHAQVNFSPSWGKRGPPSNPAQDNGPNACKTSMDALMNLYRIIQTEAQRLRDCQQFER*


>Filientomon takanawanum (Protura) AKH

MNFASHRSLLVLFAVVLGHLCLIHGQVNFSPSWGKRGPPSNPAQEQPGPNTCKTSMDALMNLYRIIQVEAQRLRDCQQFER*
>Podura aquatica (Collembola) AKH

MISQKALITLMLVIFTSGEILGQVNFSPSWGKRGANFLASNSNPNSPINIKEAQNEFINPLNSPNDNCKP…
>Folsomia candida (Collembola) AKH [GenBank:GASX01059173.1]

MKSNNVTTTLLWGAFLFLAVVALTVQAQVNFSPAWGKRGHSIPVSVQSRNGGDATLGSDHLQ…
>Bourletiella hortensis (Collembola) AKH

MALPKTAISIALLVIIAISSIHYTYAQVNFSPSWGKRTAAIMSNPNTEEMNTITENCKVPLDSILRIQKLIQLEAHKLIRCESMAGEMQRRK*
>Orchesella cincta (Collembola) AKH

MRSVFIMVALLYTFFTFTLIQADAQVNFSPAWGKRSTTDWLGESQDPTDYRKVVGIDGCQTPLECLLRMQRYPYVTPERAARLTNAKMLKTLARGDEKFD*
>Pogonognathellus sp. (Collembola) AKH [GenBank:GATD01008212.1]

MRSLSLATLFVGVVVFFIVADAQVNFSPSWGKRTSGILSDSSSSDTELPQFSDNCKIPLDSIVRIQRMIQLEARHILKCEAMNVSKK*
>Sminthurus viridis (Collembola) AKH [GenBank:GATZ01006795.1]

MSQIRAGFYITLVVAIAFLAATVVEAQVNFSPSWGKRASVAMSQGGAEEFSQFPENCKIPLDSVVRIQKLIQVNSTGLEKSRVFTFTMFSLLLILLKDHICIYLSATLVGGPQTHAL*
>Jordanathrix leptothrix (Collembola) AKH

MTQMRAAMYFTLIILGLALVSVTIVEAQVNFSPSWGGKRAISVLANNGAPDDLAQFSENCKIPIDSIIRIQKLIQVEANKLIRCETISGDVQKIK*
>Campodea augens (Diplura) AKH [GenBank:GAYN01018463.1]

MNRLIAALAAILVLMTLTSAQVNFSPSWGKRADPTEGCKVSLDTVMHVYKLIQNEAQKLLECEKFIK*
>Lepidocampa weberi (Diplura) AKH

MRPYLAALTAILLLVTLTSAQVNFSPSWGKRADTTEGCKPSLDAVMYIYKLIQSEAQRLLECEKYIK*
>Occasjapyx japonicus (Diplura) AKH [GenBank:GAXJ01103901.1]

MSRMGASSRHHQLSLALCCSVLLLALMVLQQAPTTSAQVNFSPSWGKRTAAEVGGSTGGGGGGGGVSAAAAAGSIASCRTSMDNILYVYKLIQNEAQRLVECDKYLK*
>Catajapyx aquilonaris (Diplura) AKH

MAVLAPLVCSLLLLSSLASAQVNFSPSWGKRSSESSSSNGVSADAACRNSMDNILYIYKLVQNEAQRFLECQKYLK*
>Pedetontus okajimae (Archaeognatha) AKH

MTQRLTLAVFVAIALIFACLLFDVTSGQVNFSPNWGKRAPASADGCKGSVDAVMYIYKLIQGEAQKLLECEKFSK*
>Machilis hrabei (Archaeognatha) AKH [GenBank:GAUM01163553.1]

MALRMTLAVFVVISAILVCLLVDVTSGQVNFSPNWGKRASTGVDGCKGSVDTVMYIYKLIQGEAQKLLECEKFSK*
>Meinertellus cundinamarcensis (Archaeognatha) AKH [GenBank:GAUG01236146.1]

MSQRQTFTLLFVATILVCFVVHFTSGQVNFSPSWGKRQVGEVDSCKISIDYVMNIYKLIQNEAERLMECRKLSN*
>Machilontus sp. (Archaeognatha) AKH

MSQRSALALFLVATIFVCFLVNVTSGQVNFSPSWGKRGAGNGNAAEGCKFSVDSVMNIYKLVQSEAQRILDCEKFSN*
>Tricholepidion gertschi (Zygentoma) AKH [GenBank:GASO01224229.1]

MSRLMLVVLALSTLMMMLMIDSTSAQVNFTPSWGKRGASPQDGCKASVDSLMYIYKLIQSEAQKIVDCEKFVN*
>Thermobia domestica (Zygentoma) AKH [GenBank:GASN01024159.1]

MSRTLLAALFLATILLALFVDTTTAQVNFSPNWGKRGGPASDGCKASMDSVMYIYKLIQNEAQKIVDCEKFGN*
>Nicoletia phytophila (Zygentoma) AKH

MSRHVMIMLVVAAVLLVFLDLASAQLNFSPSWGKRGGPTQEGCKASMDSLMYIYKLIQTEAQKIAECEKFGN*

..............................................................................................


>Lithobius forficatus (Chilopoda) AKH

MKQGTFLSLLVVAVIVLVAVDFTSAQVNFSPGWGQGKRSSNSDTCAVCAQTMLQVYRLLQSLEERLGGSRNLSR*
>Hanseniella sp. (Symphyla) AKH

MRAWVSLLSLTLMVLLLMGTAHAQVNFSPNWGKRGDPPCAVSKDTVLTIYSLIEAEARRLNECGSNFN…
>Eudigraphis takakuwai nigricans (Diplopoda) AKH

MRPILLSVLLLSGLVVLLLTPDTSAQVNFSPGWGKRFDIGEAGANPNCKPSVESIVEVYRLIQMEAQRVRQCEQKR*

..............................................................................................


>Drosophila melanogaster AKH [FBpp0073069]

MNPKSEVLIAAVLFMLLACVQCQLTFSPDWGKRSVGGAGPGTFFETQQGNCKTSNEMLLEIFRFVQSQAQLFLDCKHRE*
>Daphnia pulex AKH [Dappu1_114396, GenBank:EFX68649.1]

MANHRILILTLLMIGLASAQVNFSTSWGKRSPSTSTKAAEPPSAPSYRQNFHSKKVEPGTLETLPNNQHLPESFDTVSSTIYDDAEEQRISISLPSPCLSILKSLLLVNQIVEFKNSPLDGRMHRFKIENLFPLPNRTCRLYIRR*

Allatostatin A (AST A)
>Nipponentomon nippon (Protura) AST A

MSGAVKAAFSLIPCYILLALMLQCSSKALADQTDDNDIDQSIDNLKRQYSFGLGKRPASSYDDKRVPSYNFGLGKRSISDEDIDYSNPEYSKRANPNMYAFGLGKRLSSSRYAIGLGKRPNELYAFGLGKRSGGASASDGGNELDWDDETNEDAWIEAETGGPPGKRRSYEFGLGKRQSPNRMYDFGIGKRRQYDFGIGKRRSYEFSLGKRRQYEFGLGKRRQYEFGLGKRRSYEFGLGKRPQQAYSFGLGKRGQQSYSFGLGKRISADDDSTSGLDARDDLDQEPNLDAVSNMAALFHNPSSMMQRHPGFSESDSGSQQHSDDKRRDHRFSMGLGKREVNIDEMPTVGATNLNLKKTTEEPQQQQQHDEGKSNSKENSQSKPDQGIRRMI*
>Acerentomon sp. (Protura) AST A [GenBank:GAXE01139630.1]

MKLGTNRLIRLVSGSAVAILVLHCVCLTKADDYSETSEDELDQSIDNLKRQYNFGLGKRSPVFPAPNYKRVQSYNFGLGKRSNEEDLSSDNSKRANTNQYAFGLGKRLSSLYSIGLGKRPNELYAFGLGKRSSGFDPDISEGLDLEYLEEEEPKPRDSRPAEKRRMYEFRIGKRATPEKMYGFGIGKRRSYEFGLGKRKPYEFGLGKRRSYEFGLGKRRTYEFGLGKRRPYEFGLGKRPAGRQAYEFGLGKRLPQSYSFGLGKRENQQGYAFGLGKRISDLLDDSEPNFNTKTFFEDSSPSLNPVLSSSSSIESEKSDDKRKDHRFSMGLGKREVDMNELKAEDDTNQTKYQSETKSAAENATQSLRNGGIRKMI*


>Filientomon takanawanum (Protura) AST A

MGTKSSTKTVFQFVSKCVVAILVLHCVSLCTADETDESDDELDQSIDNLKRQYNFGLGKREQDTSYEGPTFKRAQSYNFGLGKRSDEEDIGSDNSKRGGHNQYAFGLGKRLSHMYSIGLGKRPNEMYAFGLGKRSGQVDHESEETDFNDVDDDETSMDNYYNGKPAEKRRMYEFGLGKRAAPDRMYGFGIGKRRQYEFGLGKRRSYEFGLGKRRSYEFGLGKRPQSYQFGLGKRLPQSYSFGLGKRDNTRSYAFGLGKRNTDLDAEAESNLNLERIYYQDNIMPLLQPGLALSGSDATQSEADKRRDHRFSMGLGKREANIDELVSADDNTRKYQSDPNSTANPMKTQSQSDKNLGIRKMI*
>Anurida maritima (Collembola) AST A [GenBank:GAUE01053897.1]

MQRILSSPTFLLMFLCSYAWTSQFPSADEIDSVRRLVLYGSSPRRFQLFEYGRRPFEEDRESLEDFSSIPSTNIDYYNDLDKRVVGNGNKYTFGLGKRSKSYGFGLGKRAKAYGFGLGKRLQKDWKNSPALLSPNYRQERRSKVYSFGLGKRSAGNSLDLDKVQEGYYEGQEGPEKSARLFSVGPGKMEVNAGTS*
>Tetrodontophora bielanensis (Collembola) AST A [GenBank:GAXI01020132.1]

MQRIGSLLMSHMLVILFVGTSYAWSRPESLGDDYDSMKRLMYSYGTYKRLPSSYDFGLKKSMEEPSSYEDMSYSPEGYSNSMDKRAPANMYSFGLGKRNRAYGFGLGKRLEQAWKIPSTSLHPSYRQERRSKIYSFGLGKRQSPDLLEDDDDQLTDKRASGGRQFNFGLGKREVDSIPLVKNTTS*
>Podura aquatica (Collembola) AST A

MMHRIGLVSPLVLLLVVGSSAWSSSGDSPYFSLLRTTGRGVDDLMRKSYEEDEAPDYYYSYGDKRAAQPLYSFGLGKRNRAYGFGLGKRLEEQWKNSATLHPTYRQERRSKVYSFGLGKRGFETIPESGDDYVEDIKEAEKKSRQFSFGLGKRESGDVNSKGLSSS*
>Folsomia candida (Collembola) AST A [GenBank:GASX01008840.1 + GASX01012811.1]

MTTAAPQVILLVLASCACVWAAQMSDNYEKMRLLYNYPSGFKRLPSYDFGLGKRSFG…
…RQERRSKIYSFGLGKRQSHDGMEDYDGNASPPTAERRASSQRQFAFGLGKRDLNAAKE*
>Bourletiella hortensis (Collembola) AST A

MQKLAIVLTAHVLIVLCVSSSAWSRQISDDSDLMKRMYSYASQLQLKRPMYDFGLGKRSLEEAASYEDLSNLPLDAYNVEDKRGAGPNSMYSFGLGKRNRAYGFGLGKRLEAQWKYPSARQERRSKIYSFGLGKRSGAGPMYNGLEDYYDMSAIQAPAAAAAADKRAAGGRQFSFGLGKRDVADASHNTTS*
>Orchesella cincta (Collembola) AST A

KRSLEEPASYEDTGYPYPLDAYNNYAVEKRASPSGMYSFGLGKRNQRVYGFGLGKRLEQAWRGVNAPSASIFPSSRQERRSKIYSFGLGKRQSPDLQEDDYEFPAAASANSDKRSSQARQFSFGLGKRDTEASDHVKTTS*


>Pogonognathellus sp. (Collembola) AST A [GenBank:GATD01099731.1]

MQRLGNILAYQLLMLLLVESYAWPREMHEDYDTKGLFPAELQSNRFPNYELYPGKRSGSAKDEVVSYEDFTSPSLVDTLNGIDKRVSPNMYSFGLGKKNRAYGFGLGKRFEHNMWKTYPASSPSFRQERSSKIYSFGLGKRGVNYDDQGRSSVSGQRQFSFGLGKRETQQSTSAAN*
>Sminthurus viridis (Collembola) AST A [GenBank:GATZ01018538.1]

MQRISSLLASQVLVILFVGSYAWSRQADESDLMKRMYSIASQYKRPMYDFGLGKRSWDEPASDEDLASALDTYNVEDKRGAPNSMYSFGLGKRNRAYGFGLGKRLENPWKYSPVSANRQERRSKIYSFGLGKRSSLPISSGSDDYYDNAGADKRSTANRQFSFGLGKRDVSEASHVNSTS*
>Jordanathrix leptothrix (Collembola) AST A

…ASQVLVLLFVGSYAWPRQVPDDADLIKRMYSYASQFKRPMYDFGLGKRSLEDQESFESSDLSAPALDAYNI…


>Campodea augens (Diplura) AST A[GenBank:GAYN01140363.1]

FGLGKRPQSMYSFGLGKRYTPSVYAMGKRPKEMYAFGLGKRSADDYYDNSIEDNGLYDGDMDKRKYAFGLGKRPMNYNFGLGKRPMSYNFGLGKRPMNYNFGLGKRSKNMYSFGLGKREVDNDQFVKSDEGGNVEATEKSSVVEEAGKPNELQHERTKRAAPSGLYSFGLGKRRPFDFGLGKRNRMYSFGVGKRDYEEVEDENLYE*


>Lepidocampa weberi (Diplura) AST A

MHYGSWMSGSSSFLLCLFSLVVLVTLTRCQDADVDLSADPYYEPSIDDLAAVDKRPSAYNFGLGKRAGNYNFGLGKRPNSMYSFGLGKRYNPYYEMGKRPKEMYAFGLGKRSADDYYDSIEDQDGGAWVDEVDKRAGKYAFGLGKRPMSYNFGLGKRPMSYNFGLGKRSRNMYSFGLGKREVSQEQYGSKNDVTTTEKPSGETQEKHDRKKRASGMYSFGLGKRRPYDFGLGKRPRYSFGVGKRDYEEPELEGTYE*
>Occasjapyx japonicus (Diplura) AST A1 [GenBank:GAXJ01108915.1 + GAXJ01107315)
MLPGGCRSLLMLAVWLYWSSVLLVTGAPSSSSSASSSSSSPASPSSAAALVHVPLELVEDDPEDDLDLDKRAYSYVSSYKRLPVYNFGLGKRGKMAYSFGLGKRPQQMYSFGLGKRINPMGKRPKEMYSFGLGKRDASEYDDGRDWELVDLPEQEEGEEQEDGEGEAPEGGEEEEEEEGEVDEPEGKRAQGMYSFGLGKRRPYSFGLGKRTQGMYSFGLGKRAPMYGFGLGKRERMYGFGLGKRERMYGFGLGKRPDGNSRQRFAFGLGKRTATEDESPEEEVKREVKRSELEAVRKEGAAAAAGSLEKPAPSANQQPNADAESKVKRALYSFGLGKRAYDFGLGKRPKQYSFGIGKKSLEEEEEADEDRVGMSQ*
>Occasjapyx japonicus (Diplura) AST A2 [GenBank:GAXJ01074849.1 + GAXJ01075325.1]
GPYSFGLGKRAPLYSFGLGKRASGGRQYSFGLGKRLNNNHRQYSFGLGKREVSASEAAAVAAEAAAAEEHVVKKRSANPEQLEWADAETSRSDEEQMSSVPGPAEFGRAGRRTYSFGLGKRLPLYSFGVGKRLSA*
>Catajapyx aquilonaris (Diplura) AST A

MPGAMIPAGCRSLLLLSVWLYWSSVVVSSVPSPTSSASSVLPVELMDDPDDDLQQLPYPSDLDKRAYSYVSSYKRLPVYNFGLGKRGNKMAYSFGLGKRPQMYSFGLGKRVNQDYGYPAMGKRPKEMYSFGLGKRDTSEYEDWDDNNSQEEDKRAPKYAFGLGKRRAYSFGLGKRSPQMYSFGLGKRAPMYGFGLGKRERMYGFGLGKRPDYNSQRFSFGLGKRSMEEEDEEDAEDKREVNPSEMEEVRQEADNQAEVKRRSPYSFGLGKKAYDFGLGKRPKQYSFGMGKKSEGMSQ*
>Pedetontus okajimae (Archaeognatha) AST A

MGRTNRHLTQFQSTAVIVFLIFGVSIATTLDEWQADEFSESSLEDEDSTLDAYKRLYDFGVGKKSYLYEDKRMPAYNFGLGKRAPSYNFGLGKRLKNGKIVYPYGPGNPTNRYNLGLGKRPSHLYSFGLGKRSGSDMGFSDDEYEYDMPVEDGKQEDEKRSKMYNFGLGKRDRLYSFGLGKRTPNMYSFGLGKRAPKYSFGLGKKSDSRLYSFGLGKRSAPYERFNFGLGKREYDTSYEDYGDEEKRSGHRYSFGLGKREVDSSEQRYIQEQEEERNHDNSNELSADKKSRAYNFGLGKKNFILQNAKNESKHSETKQAAVPHHGNREKRSTPQYSFGLGKRDGFENSIEAMQYAEDPEYNSVEAPSTYRVAKKNKMYSFGLGRRSGGGQQIPLYGFGIGKRSTDDASEVH*
>Machilis hrabei (Archaeognatha) AST A [GenBank:GAUM01012727.1 + GAUM01078271.1 + GAUM01025621.1]

MGWSNRHLSQCQTTFAVLFLIFGVCIAAASDEWQSDEFPESSLAGEDDSAMDAYKRLYDFGVGK

NFGLGKRVPSYNFGLGKRLRNGKVIYPFGPANPSDRYGQGLGKRPSQLYSFGLGKRSSNDMDLSDDEYEFDMPSEESDQ…



SFGLGKRTPNMYSFGLGKRTPMYSFGLGKKSDGRLYSFGLGKRSAPYQKFNFGLGKREYDNGEEDYEDEEKRSGRRYSFGLGKREVDSSEQRYILEEEQRNHDNAKEFADEKRSREYNFGLGKKDTIPEHVKNQSTNSQSKEKDTRLHGAREKRSTSRYSFGLGKRDDMDNAIEAMQYEEDPEFSSFEGPSTYRLDKKNRLYSFGLGRRSGGGRQIPLYGFGIGKRSTDVNEANLEVH*
>Meinertellus cundinamarcensis (Archaeognatha) AST A [GenBank:GAUG01035062.1]

MGLLSKHHIQIRASLSVLLVLLCLSTTAAVDDWESEIVPESSIEDDDNSIEEYKRLYNFGLGKRSYSNEYKRLPVYNFGLGKRGHAYSFGLGKRAKSGSSSMYSFGLGKRPNSNKYAFGLGKRPSQLYSFGLGKRSSDDSEFSDDDYDIEASLDYGTPEDKRGKAYSFGLGKRDRSYNFGLGKRAPSMYSFNFGLGKRDYDEELDEIADEVKRSNGHRFAFGLGKREVDASEMKDLNAELSQNVAADIKHETEKRAAYNFGLGKKSVEAHHEKNHTTDEEVQSSQTSHHHGHLVKRSPSPYNFGLGKRDDVDDDVEFDEPEVFEKPSTYLMDKRSRASAFGFGRSSDGRQMPLYGFGIGKRSTSNEDSLEVVH*
>Machilontus sp. (Archaeognatha) AST A

MGNYRHHIAFPASLTALLMIFLVSATTATDDWPNEEIPETSMEDEDNSLEAYKRLYDFGLGKRSSYSNEYKRLPIYNFGLGKRAPMYSFGLGKRSKSGSSMYSFGLGKRPNGNSKYSFGLGKRPSQLYSFGLGKRSSDDTMFSDEEEYDMDNDYDTSEEKRSRQYSFGLGKRERMYNFGLGKRSPSSMYSFGLGKRSRTYSFGLGKRPSDRLYSFGLGKRSDGRRYNFGLGKRDYDEDVEDLDSEVKRSNGHRFSFGLGKREVDPSDISDIRAEAERMNAENEETHNTEKRAVYSFGLGKKSEVSEPGKNKSSENEQGSEDTHNHKQPVKRSPSPYAFGLGKRDDIDNLDNIDFEESDPIERPSTYLMDKRSRPYSFGLGKRSGYGRQIPLYGFGIGKRSITSSENVH*
>Tricholepidion gertschi (Zygentoma) AST A [GenBank:GASO01229841.1 + GASO01255089.1]

MHWPVFHRLLLCLVVYITFLLLGITTAEDASVALPDSDVDVDEELYKRMYDFGLGKRAYSYVSEYKRLPVYNFGLGKRSTGMYSFGLGKRSPSRESSKLYSFGLGKRTRPSQMYSFPQTKRVKL…

KRNRVYSFGLGKRAKAYSFGLGKRLPQKMYSFGLGKRVPMYSFGLGKRSGGRPYSFGLGKRPMSPKQSSSRFNFGLGKRDAGYPYFYDEESDDGAEDLIHEEADKRGEQRFSFGLGKREVTPQEINAFQQELNHHYDDGEKSMNHEDKRSKAYSFGLGKKDSSPGNENDTRDDKSNQSQHPGGVVKRSPHYSFGLGKRDDEEDQDVSDDWAEDISIAEDNNDDKRNNHRYKFIGLGKKTPGYEYSRPGRRTYSFGLGKRLPMYDFGIGKRSTDSSAIH*


>Thermobia domestica (Zygentoma) AST A [GenBank:GASN01396887.1 + GASN01407427.1]

MLSSFKPLDNMSSFKCWIFVFVVFILSVMAEDLETSGASREVPVDDIDEATLDLYKRLYNFGLGKRAYTSLSEYKRLPVYNFGLGKRSPGLYSFGLGKRSPPSNLYSFGLGKRVRPSEMYSFGLGKRSWSYEDDYPEEENNQEEYDDDTEEEKRNNRLYSFGLGKRARSFNFGLGKRDMQRLYGFGLGKKSGMYDFGLGKRGMRDYAFGLGKRPVPRLSNSRFNFGLGKRDPGYSDGDQFDQDEEYWQDEADKRGEHRFAFGLGKREVAPQDIAALKEELDKDKSKNNDEHEHGSANKSSQTVSENSTGADKGSQNINRVDMQDKDGSAANSYHLVKREEEASNYWVDDAEDIEKRNPRYKFIGLGKKTLGYEIRRPGRRMYNFGLGKRIPMYDFGVGKRADISADH*
>Atelura formicaria (Zygentoma) AST A [GenBank:GAYJ01034351.1]

MLTSRCRDLLLFAPLWVVLLTLNVMADDIAAELSDLTDEDGLQLTDADESAADIYKRLYDFGLGKRAYSYVSEYKRLPVYNFGLGKRSPHMYSFGLGKRLPSGSSGHLYSFGLGKRTRPNEMYAFGLGKRPAWGPDYDYSEEDVEEELEPELEEDKRNKLYSFGLGKRARSYSFGLGKRQKQYSFGLGKRPMYDFGLGKRSGKQYSFGLGKRPQPSRDGSRFNFGLGKRDPGFSYYDEDESSPRSEEMFHDEEDKRGEHRFSFGLGKREVPSQEVEALKQEMSHNHQGEVKSDISEDKRARTYSFGLGKKSDNNGTAEVAAAADNHQDDDEHLAGHIKRSPHYNFGLGKRGDGEWSDLPLMEAEDKRNPRYKFIGLGKKTALSGSGGPGSRRMYSFGLGKRRPMYDFGLGKRSE*
>Nicoletia phytophila (Zygentoma) AST A

MFEPRLHHLLFYAPVFILLLTFEVHGDDLSTELNEAASAEDGQLLSDSDEDAVELYKRLYDFGLGKRSTSFASQFKRLPMYNFGLGKRSPSMYSFGLGKRTPGMYSFGLGKRSPGMYSFGLGKRTPGMYSFGLGKRTPGMYSFGLGKRTPSKSQGLYSFGLGKRPAPGQMYSFGLGKRSPFSAEYDYEEEESEEDADEPEVTEGKRDAKMYSFGLGKRSRMYDFGLGKGKRRSRMYDFGLGKRKADRLYSFGLGKRLPMYDFGIGKRGMQPYAFGLGKRASPSRQSGLFNFGLGKRDHDFYDDDEENEELNEDMLSEEGKRKDHLYAFGLGKREVPSQEIDDFKQEMDEKHLEDLKHEGHSEGKRNKVYSFGLGKKSQVNGSGEVAESLDNQQGNDDHLAGRIKRSPHYYNFGLGKRSDDLEEYDSEEWNEVPVMDETEGKRSPRYKFIGLGKKTSGNGLSGPGRRLYSFGLGKRLPLYDFGIGKRSDH*

..............................................................................................


>Xibalbanus tulumensis (Remipedia) AST A

…ESSPDKRLATYGFGLGKKAYDFGLGKRAYDFGLGKRAYDFGLGKKALDYGTGLEKRLSSLYTLEMGKRLSELYKSGLGKRPGEMYSFGLGKRSDSSVDDLEDDDGLDEEKRGSAAYSFGLGKRDPAQYAFGLGKKDRGPYEFGLGKREQHSYAFGLGKRDPQAYAFGLGKRDPYGFGLGKRDPYGFGLGKRDPYGFGLGKRDPYGFGLGKREPYAFGLGKKDPYAFGLGKRDPYGFGLGKRFPYEFGLGKKAPMYEFGLGKREPMYEFGLGKRDKGMYHFGLGKRHEFKEDYRRFDFGLGKRNDELDETGEDEKRDGNKFSFGLGKREVDPTELDDMLMRSDDEEEKKRSMSYGFGLGKKSASDSDTEKDNFSENNEHLIPKEKRSPAYGFGLGKRQKHKKAYDVSVGETIKPYNSKIEKSERKTGSVGQ*


>Anaspides tasmaniae (Malacostraca) AST A

…DDSLPAKRAYTYVSEYKRLPVYNFGIGKRWIDNEDKRERYSFGLGKRSRQYSFGLGKRNENSDYPDRLGFDYVPASGTPDRSPG…

GLGKKAGTYSFGLGKRSDPIAYRVGRSSYDFGLGNRNNQNTNEVYNYTVGEEAVNL*
>Lithobius forficatus (Chilopoda) AST A1

…DEEAELSAEVEEKRNKMYGFGLGKREDEDMESAKRNKGMYSFGLGKREEEKRNKMYGFGLGKRNKGMYSFGLGKREAVDDEDVEKRNKMYGFGLGKREEEEKRNNKMYGFGLGKREEDAKRNSKMYGFGLGKRDEDNMEEKRSKSYAFGLGKRDSDSELEEDKRSKSYSFGLGKRDSDSELEEKRSKSYAFGLGKRDSDSELEEDKRSKSYSFGLGKRDSDS…


>Lithobius forficatus (Chilopoda) AST A2

GLGKRDSDSELEEDKRSKSYSFGLGKRDQGDDELEEKRSKSYAFGLGKRETDSNNENNEEKRAKSYSFGLGKRDDEDEGPEVKRAKSYSFGLGKREEDDEAMEKRMKSYGFGIGKRGGDAENVDKRNKNYSFGLGKRGAEEVVNESEDKRAKPNQYAFGLGKRTASAEEHKAAAAVSTANDSATPHH*


>Hanseniella sp. (Symphyla) AST A

KRGPREKLYSFGLGKRATIATQVEPSSRENSRTEFDLGKKNDSDSSSVDAKKVSTARPAASS*


>Eudigraphis takakuwai nigricans (Diplopoda) AST A

…LVKRARSFGFGLGNRSRSFQFGLGKRSSEEGEDEVVDEDEILPDEDKRTKSMAFGLGKRSQKQFGFGIGIRPNQQFSFGLGKRAQAYTFGLGKRPDRQFSFGLGKRPSSQQFAFGLGKRAKNFEFGLGKRAKPYTFGLGKRSVDESNQLMVASNETARSIEDTRQSNGGQSKSQPDVQAVHKEKDRSGQR*

..............................................................................................
>Drosophila melanogaster AST A (FBpp0084119]

MNSLHAHLLLLAVCCVGYIASSPVIGQDQRSGDSDADVLLAADEMADNGGDNIDKRVERYAFGLGRRAYMYTNGGPGMKRLPVYNFGLGKRSRPYSFGLGKRSDYDYDQDNEIDYRVPPANYLAAERAVRPGRQNKRTTRPQPFNFGLGRR*
>Daphnia pulex AST A [Dappu1_312277, GenBank:EFX87432.1]

MLFLSTALFLLVALLQSSQCTDVNNDSSVIEAVGAGGGDSQAKAESLASAEDKLSALTADGMATRARYFKSFGGNPTGDPNLNIYSFGLGKRTSRSYSINPYSFGLGKRGGNAKSYPQQIPYSFGLGKRNPTKYNFGLGKRPDRFGFGLGKRNLKDDDLDQWLNDEEYSQFDDTEEEIEGREDDSQEIMDVNKRSQMAAGQQQQQQQQAFFPSHLQSAFYGGPFMSNLARANTHALGKSRTFNQQAATHDLPNLGKRLPVYNFGLGK*

Allatostatin C + CC (AST C + AST CC)


>Nipponentomon nippon (Protura) AST C

MNTDSIRLVLLLSTMAITISLGMGNPQQQSPHRRLQSVNDLDLIEDDGELETALLNYLFAKQIARRLHSQLDIQDLQRKRSYWKQCAFNAVSCFGK*
>Nipponentomon nippon (Protura) AST CC

MMFELHLWTMSSSLLFAVLAFLLRPEFSLCLQDGHPAYYLTPLQVKVKRGEVNLERVDTLYLPEKQPNLDSNQLVIKRSSFLMDKLRLALENALEEDERILELKQKQQPIQTKADDATRYEEEHQQRAAKLKATAAYQLTPAAVAQLEMQRRGQQDGRVYWRCYFNAVSCF*
>Acerentomon sp. (Protura) AST C [GenBank:GAXE01005791.1]

MKSESVSLFILLALAVVIGLVQSHVTKGSSNHHQFQSTQDLDLMEDDGELETALLNYLFAKQIARRLHSNLDIQDLQRKRSYWKQCAFNAVSCFGK*


>Acerentomon sp. (Protura) AST CC [GenBank:GAXE01125568.1]

MMNRMDQMNIMCCFIWVLLAFLIISVVSANPVYILTPFVSKVKRGEVNLEKPETLFLPEKQMESSLLDHPLMGEQSKKSTFLMNKLRYALENAINKEERLIE…


…KNYLLTPSAVAQLEMQRRGQQQDGRVYWRCYFNAVSCF* [GenBank:GAXE01135524.1]
>Filientomon takanawanum (Protura) AST C

MNIGAMCLLALSALVGLVHCHSAKASPSRHQFQSAQDLDLVDDDGELESALLNYLFAKQIARRLNSNLDIQDLQRKRSYWKQCAFNAVSCFGK*
>Filientomon takanawanum (Protura) AST CC

MLAILVVVVLAAIPLHSVGGSPVYILTPIMSKVKRGEVNMERADPLFLPDKQTDTNSMELAIPFIGDQSKKSTFLMNKLRHALEN…

…KLKATAAYQLTPAAVAQLEMQRRGQQDGRVYWRCYFNAVSCF*


>Anurida maritima (Collembola) AST C [GenBank:GAUE01052945.1]

MPRWMIEVGLLLVFSITLATSSGKRLSHEYAFGGLNNQGAAGDLGQSQQPSMNGAIFPPEIESGNKGTGILNLDSPEGGWEDSAGSMENALMNYLYRKHMIQKMKQQIATDNLRQQQRKRSQGQYWKMCAFNAVSCFG*
>Anurida maritima (Collembola) AST CC [GenBank:GAUE01008269.1, GAUE01008268.1]

MTLILCVFVSFGWSDPVPSPEPKKAHEVSNGSLQDRKVEKEKALEVVKRSAEESDEEETPTVYYPMIISKKSATVLNKLVTALRNSIDRNPMRNANFLREKELVSLRNSANYDMFNLQRRNQKERKNYLRCYFNAVSCF*
>Anurida maritima (Collembola) AST C-like[GenBank:GAUE01009178.1, GAUE01009177.1]

MAMSATLHNFLMLATFVILFATKAMGAIDPLENGVFGPIETINDEESGNRNRANGFERQEYQNVPMIGTRWPTDNNQDWLHLSQMMKLLLGGIQNRKANEQQSLDVPRTPQRQSYGKRQIIYRQCFFNPISCF*
>Tetrodontophora bielanensis (Collembola) AST C [GenBank:GAXI01143148.1]

MGKWIGTGILIIILVSLQLLDSTDGKTILPQQQQQQQLQMQQQQGSQDDKSGVLIPDMDVNDDEGGGNVEASLLNYLYTKQMLQRMKQQLELSDPMRKRSYWKQCAFNAVSCFG*
>Tetrodontophora bielanensis (Collembola) AST CC [GenBank:GAXI01133916.1]

MMMIIKFHGIPLLLIFSFFLTICICAHIPNNPKQSSSSSTTLDVANANKIMNKVSKYTKRDLVEQDEDDNVIFPMVISKRSATALGKLMHLLRTSMDHSGGKIISSSREKESSPMHSANYEMFNLQRRNQKSNYLRCYFNAVSCF*
>Podura aquatica (Collembola) AST C

MSYMRLVSNMRNVGVKAFTSLIFLLLISCADSKNIGHSGGDVISSEISAPNLQQQFLPEEKQQNPLYNFETSDVVYDDGPLFPSPMENALFNYLYTRRMMKKVKEQSPIDFNAANNILKKRNSNGNYWKQCAFNAISCFGKKK*
>Podura aquatica (Collembola) AST CC

MVKIGRKSFISSTFIILIFLIIIISSAASKKHHKRARVLNDTLVIDRDGEIKRNSTNYQNLTQVESKKAEKLPNVKKSEIEVSDSQNLDRNGGGDEQSLKNLKIGKRSIIEELYDVDEGQVEEEPLPPMLISKKAAKSLNKIANVIRGSYDYKPRNSYRQREMMTRSGATNEKMYNIIQRRNPKERKNYLRCYFNAVSCF*
>Folsomia candida (Collembola) AST C [GenBank:GASX01079362.1]

MVTAAYKTSWTVLILPFIVVVMATLISASPSGSPSSEDLLGSRVYYRNRETLSNPEDNVVPITLDAGQQSSPMLYDPHVLSAQAPSDNALITYLLTRRFALANNNRLRSYVDSSSNEISRKRSYSKYCAFNAVSCFGKK*

>Folsomia candida (Collembola) AST CC [GenBank:GASX01011215.1]



MMNLILILAFSAVLPSSIVCGTIARTSSDMKARPPILNQSLPPSPLLASHSKNYNSSHPASRNLDAREKREIPAEANDVLFPDYRISEMMPKRAAAGLNKIIYVLRNSFDKAAPSSPENDVGSRENDNFSGDINRALVRGSSVDRFPAALVERRGQAAQKDRKIYLRCYFNAVSCFRKKK*
>Folsomia candida (Collembola) AST C-like[GenBank:GASX01004300.1]

MKTLSFLIVTLFVLSSDFNSCCEAQKVYKLDPETMSDDDYSPEMDLVGPSSPPQSSEEMNIKPNFPSRFTSLASSPQSYNYFTPGGKRYLLSNTQLSTLNGHSPKYILQPSTRQSGFIPQQKSYYGRMSGFGMGGFGGVVGGGGRHSSAFMPPVSPRKRQILFRQCFFNPISCF*

>Bourletiella hortensis (Collembola) AST C1



MQLAVGILVIIMIIGSSLSSPISQHVLDDPEAMAGLQLEMSPGEADMMASNNGGVEGRNERDLYVTPLLLWKLLQLSRAHQEPASPPKRNHYKQCAFNAVSCFG*
>Bourletiella hortensis (Collembola) AST C2

MGPSGILKIFAILWVIAVATAMNLPVRPSEEIVDSPQDLELVQELQENSKLNPITFTPLERLVMRLRGSKRSWRPCTFNAVSCFG*
>Bourletiella hortensis (Collembola) AST CC1

MDIKSFVILLYFASFQAVSSMPYEDVPRTDLSKRSAAALSKFLLQSLSNQMEAEGKTAAGLDPVYLAHAQRRLLDQQLASPYRSDTVVNLERREPKQNEGARKYMRCYFNAVSCF*
>Bourletiella hortensis (Collembola) AST CC2

MMMMLMGIINPFSASSASNNNGMVMARTIPASALDQLDYYYLPDRNLVMASATALNKLMLALRSYEKASPEKSNVGKAVGGDLGKAGSGSNLDTFNMQRRNQKERKVYLRCYFNAVS
>Bourletiella hortensis (Collembola) AST C-like

MKLCQLFEILLIAICFCGCCLCKPFYVDYEDVEELESPGAGGDGSAKNVPEVPMSPSMVAAATATGMATPLKRSSTDTESENTWNGGGSNNGMIRHTLKVPTNDRPRFVTQPENNGWYLNSPSATVARHIPVRLFPTYNFQPQSSSSGMRRTSPFGLRKRQSILYRQCFFNPISCFKK*
>Orchesella cincta (Collembola) AST C

MAKVIVLAVPLILLAVNNSFAAPATSNEDQIGFAPARQVFRSRENPXLAEYNIVPLIPDPGIPAENTLDNQQNVEALLKYLLARNSYFTNRLRPFSSLDSAGNELARKRSSYSRSRYCAFNAVSCFGRKK*
>Orchesella cincta (Collembola) AST CC

MVCITHFVVSLFILVLPFEISGFTIKRDSKAKSPPIQLNGMESPSTIAPTHHVPLNSVPSRSLSVVKREVMTDDGRVSNLYDPGLMIMSKRSAAALNKLMSALRSSFDEPASNSFENASETATQDNGRFPTVGFRTSGSGFNSGTYTSNAVQRRGSKDRKVFLRCYFNAVSCF*
>Orchesella cincta (Collembola) AST C-like

…IPGVSYPSSFEDGPKRYPAQPQISSESSPDINSAENPGFRIRQKILNLRNQYGDKWLSLVGPYAYRKRQILYRQCFFNPISCF*


>Pogonognathellus sp. (Collembola) AST C [GenBank:GATD01094276.1]

MVSKTSKSTLWTLSILLTTANLIFAAPSINNEESSGSRAFIHSAPGGLPPSEFDLMPMVEQDNAVQASLPYQYVPIPATPVRQPSFENAILNYLSAKHLMMSLLNSKARRFNDWDSNEVNRKRSYKLCAFNAVSCFG*
>Pogonognathellus sp. (Collembola) AST CC [GenBank:GATD01099903.1]

MNSICIVFCVFLLPAFALCKPAVTVIKSSTVSEDNYSPNEANLTKRTDPANLADFQPLSIVKRDVGNMENELYSQHPYPMIMLKKSATALNRLMYRLKNSFDKSGPSKEIGPRTSYYKQDSDKSLGLSPGSAMQNDESYPLLQRRDQKERKYLRCYFNAVSCFKK*
>Pogonognathellus sp. (Collembola) AST C-like[GenBank:GATD01087920.1]

MAKVFHCSTIFLLSSIFFACFNISEAATFPGAFMNGIDRTMLDEYRERSRLANSEFGDLQPEENAWSPAKGLSRIPETLTWEDTDASNTVGENDMESRADEEKSGFIKVNVRAFNPPSRLRQIENVNPRLAFELLRKKSMKAFVPYPQKKRQIHYKQCFFNPISCF*
>Sminthurus viridis (Collembola) AST C1 [GenBank:GATZ01099087.1]

MYKLTIVLLGLTLISKSLCKSIYEDIEADNANVPQQQVSFQEEAPSPAIVLARRLAALSRLQDQTDAEMKRSRWKQCAFNAVSCFG*
>Sminthurus viridis (Collembola) AST C2 [GenBank:GATZ01099226.1]

MQFLALALVLTTIMISDSLSSPVSLSREDQEAVGFPLTLDAPSLSSDPELLQESDNRNDKEVLVSPILLWKLLQLSRLHQEAGSKRSHYKQCAFNAVSCFG*
>Sminthurus viridis (Collembola) AST C3 [GenBank:GATZ01013412.1]

MTVKISLKILAVLVALEVVLAVNTLPVRPEDDTELGGDIDTMVQEIQENAKSNPITFTPLARKLLMMRLQQEVKRSWRQCTFNAVSCFG*
>Sminthurus viridis (Collembola) AST CC1 [GenBank:GATZ01099567.1]

MGMNPKSPLFILFSLSLAMTILSSYTMARTLPSSSLDQLDFYRPDKTLMISKKSATALNKLMIALRSIDKSSAEKGNGLDSPDTVKYNPAFEPFNMQRRNQKERKIFLRCYFNAVSCF*
>Sminthurus viridis (Collembola) AST CC2 [GenBank:GATZ01101435.1]

…SLKRSANALNRLILQSRRHKEEPGPTEDHGRKMHTALGIVAHEALLSEINELIEDQKDYNTNHMERRGPKPDQRTFSRCYFNVVSCFK*


>Jordanathrix leptothrix (Collembola) AST C1

MHKITIFLLGVTVLHVVLSKPVYDDPDSEIGVSSVIENGQQEDLIPAVNLARKLLILSKLQEQNDREVKRSRWKQCAFNAVSCFG*
>Jordanathrix leptothrix (Collembola) AST C2

KRSHYKQCAFNAVSCFG*


>Jordanathrix leptothrix (Collembola) AST CC

IPSSASSSSASFFVLLFMMVMSSTNLMVIGPSAVSAAMTFPSLSSSSTRQLDFYRPDKMFMMEKKSATALNKLMIALRSYEKTSAEKGNNNGDTTGNGNGKYGTGVDTFNLQRRNKQNGKIYLRCYFNAVSCF*
>Campodea augens (Diplura) AST C [GenBank:GAYN01141404.1]

MSPVALISPRAFLLITLLTWAAVATVNSMPSPDKERVYQTDLDLVGDDGSFDTALINYLFARQMINRLKNQVDVTDLQRKRSYWRQCAFNAVSCFGK*
>Campodea augens (Diplura) AST CC [GenBank:GAYN01089093.1 + GAYN01130244.1]

MEKFSSCILDMIIVLFAFSFFLSLCLAGPLDITAKEQIQNHHILKRDAEEPDYYPTDLENVQLP…

…DKLASTSQKIIDEPVGGGSRYAEGPIAAPLTDVRQVLKKVGLQRRGQHNDRVYWHCAFNAVTCFKKK*


>Lepidocampa weberi (Diplura) AST C

MSPLFLVSPRSILILLVLTWIAVTATKALPTPEKERTPYQTDLDLIEDDGTLENALINYLFARQMVNRLKSQVDVTSLQRKRNYWRQCAFNAVSCFGK*
>Lepidocampa weberi (Diplura) AST CC

MEKYSSCIQDMIVLLFTFSLLISLCLSRPMEANNSKTLGSHVQKRDIEEADYYPTEDENPQVLQNQKRISSWAFGKLADTVQKIIDEPVGGGTRYAEGPIAAPLTDVRQVGLQRRGQHNDRVYWHCAFNAVTCFRRK*
>Lepidocampa weberi (Diplura) AST C-like

MMMMHCPLQWRWNACFWGVAIGILSWGLLAQATPLMTNYPGNILEDTDNSPSKSLGDWSLGLPKSAGSSEDRGALLHPAQFPVSWNYLTAPKDRRSFFSDQKQPAEKRQIRFHQCYFNPISCFRRR*
>Occasjapyx japonicus (Diplura) AST C [GenBank:GAXJ01012337.1]

MHPDSACRFLLIFLVAMAILNVANSKNLPGESERDRLAAAGLTEEDNNAILDDDVMGYLLTKSMVKRLRNQVEASDMQRKRSYWKQCAFNAVSCFGK*
>Occasjapyx japonicus (Diplura) AST CC [GenBank:GAXJ01011505.1]

MEGRGCWRRRASTAALVLLQLFFCVGLAQQPQQQTQTQPREVSGAGNNHTAEGLPQQQVGDSNSGSREEGQGQQQMMVRKREAEMAGPQLDLLPMPHNDKRAALILDKLMFALQKALDEPEETFGAPAAPVPEALRAPQVDLQRRGQIKGHYYVPCFFNAITCYRKK*
>Catajapyx aquilonaris (Diplura) AST C

MHLSSTCRTLLLLLVAAAVFVNVVNSLTIPNSEEERRRYPRVLADDEDAVDNYQMNYPLLKAFLKRLRDQDVVTDMERKRSYWKQCAFNAVSCFGK*
>Catajapyx aquilonaris (Diplura) AST CC

MEGRTCCRQLGTAALVLLQLCFVGMAHPQQQQQAQVIQQEQQVNRSGMHLKNKREAEMPVPNQQDVQMPHNDKRAALILDKLMFALQKALDEPEEGYGPAAPVPEALRAPQVDLQRRGQTKGRYYVPCFFNAITCYRKK*
>Pedetontus okajimae (Archaeognatha) AST C

EAKSIGQGEKEQFVSDLDLVEDDGTVDTALINYLFAKQIINRLRNQLDVTDLQRKRSYWKQCAFNAVSCFGK*


>Machilis hrabei (Archaeognatha) AST C [GenBank:GAUM01172669.1]

MASCKWIVLLSLVGCVALGWSEAKSLGQGEKEQFVNDLDLVEDDGTVDTALINYLFAKQIINRLRSQLDVTDLQRKRSYWKQCAFNAVSCFGK*
>Meinertellus cundinamarcensis (Archaeognatha) AST C [GenBank:GAUG01190451.1]

MASCKWFVMLSLVSCVALAWSDAKSLGQEEKQPYLNLDLVEDDGSVDTALMNYLYAKQVINRLRSQLDVTDLQRKRSYWKQCAFNA
>Meinertellus cundinamarcensis (Archaeognatha) AST CC [GenBank:GAUG01241714.1]

MALQRDSSIFVILCALFLVLIFNVPQGSTSKATLYYPQLSDRIAAESTTVVSKRAALLLDKLMYALEQVLDEDKTGKQVLAAAPAAPQEPTYPVEQMELQRRGQQKGRVYWRCYFNAVSCFKRRK*
>Machilontus sp. (Archaeognatha) AST C

MAAYKFFVLLSLFSCVVLAWTEAKALAQGEKDDLSMVDDDGSVEAALMNYLYAKMVVRRLQNQLDISDLQRKRSYWKQCAFNAVSCFGK*
>Machilontus sp. (Archaeognatha) AST CC

MALQRSLIVLTSTLLVVVFIILPQGHCAKATLYYPQLSDRFGTDSTAVVSKRAAILLDKLMFTLQQALDGEMGKQTDSQPPVPQAQTFPIEQMDLQRRGQQKGRVYWRCYFNAVSCFKKRK*
>Tricholepidion gertschi (Zygentoma) AST C [GenBank:GASO01249200.1]

MVSTKLMLVMMIAMVTLSWAFGKTLGQPEKERFLNELDLVDDDGSVETALMNYLFAKQIVNRLRSQLDVTDLQRKRSYWKQCAFNAVSCFGK*
>Tricholepidion gertschi (Zygentoma) AST CC [GenBank:GASO01248131.1]

…TRETLVVPKRAALLLDKFMVALEKALDDGASSDSAKSTPVVAPEQMGLERRGQQKGRIYWRCYFNAVTCF*


>Thermobia domestica (Zygentoma) AST C [GenBank:GASN01005788.1]

MMTTKCMLMLAVAMLTLSWAFGKTLGQPEKERFINDLDLVDDDGSVETALINYLFAKQIVNRLRSQLDVSDLQRKRSYWKQCAFNAVSCFGK*
>Thermobia domestica (Zygentoma) AST CC [GenBank:GASN01397206.1]

MGHFSSLGLVFGACFLTLIWLCLPSPATCRTTHLFDDSSAALETQDYTTGVRYDEYPVVVPKRAALLFDKIMAALQSSLDEGGGTRTEYVVPEQMDLQRRGQQKGRVYWRCYFNAVTCFRK*
>Atelura formicaria (Zygentoma) AST C [GenBank:GAYJ01274481.1]

MARRILLVLLVAMVTLSLAFGRTLGEPEKERLLNELDLVEDDGSIENALMNYLFAKQVVNRLRRQLDVTDLQKKRNYWKQCAF
>Atelura formicaria (Zygentoma) AST CC a [GenBank:GAYJ01022806.1]

MGRSWAAVVLVTWLCLTVESKPLTRDMAEQDTLLDTSMDYRLGVRYDDYPVVVPKRAALLLDKIMGALEKAWDEQPQPAATNRVMDSQIQRRGQQKGRYVRCYFNVVTCF*
>Atelura formicaria (Zygentoma) AST CC b [GenBank:GAYJ01022807.1]

…DSQVDRRFGDVPSPKENGTGIRSTKEKALTDLARGKYSQLSQTDSRNRSIQRRGQQKGRYVRCYFNVVTCF*


>Nicoletia phytophila (Zygentoma) AST C

MARKLMFVLLIAMVTLSWAVGRTLGEPEKERFVNELDLVDDDGSIENALINYLFAKQIVGRLRRQLDVTDLQRKRNYWKQCAFNAVSCFGK*
>Nicoletia phytophila (Zygentoma) AST CC

MGQSLLLVITCLCLNAASQPISEDEDERDVLNPPEYRVGVRYDDYPVIVPKRAALLLDKIMGALEKAWDEEPRVAAIHDSRNSQVQRRGQQKGRNSLRCYFNVVTCFK*

..............................................................................................


>Xibalbanus tulumensis (Remipedia) AST C

MSTFYRIFVYLLVIFVAVSAVIGKSLSQVEKERFGNELDLVDDDGSMENALLNYLFAKQMVSRLRSNMDVSDLQRKRSYWKQCAFNAVSCFGK*


>Xibalbanus tulumensis (Remipedia) AST C-like

…VNLQDRDKAMNNFWKLLGFNGFDIRDSSKSAPHQSAFVDSSAASSAGGYRNLAEDVDLPYGAKMLGSKRQIRYHQCYFN


>Anaspides tasmaniae (Malacostraca) AST CC1

…PRSRPLHTNPMELQRRGNTDGRLYWRCYFNAVSCF*


>Anaspides tasmaniae (Malacostraca) AST C-like

…RDFDESIGKGEARVQKRQVEQNEASEERELAALRSLILQRLISEMQSGEWKDLPIFRANGLDDSVEEGVEKQKRMFDALPVARGQFPATKRQIRYHQCYFNPISCFRRR*


>Lithobius forficatus (Chilopoda) AST C

MESSKIFALFFLLFLAVSVVVSKSIGEHENPNYGPDLSLVNDDGSLDTALINYLFARQMIKRLQSNMDVTDLQRKRSYWKQCAFNAVSCFGKK*
>Lithobius forficatus (Chilopoda) AST CC

…QPQKRSTLLLDRLVYALQKAIKQDAVQQQDMELQRRGPDRRVYWRCYFNAVSCFRRK*


>Lithobius forficatus (Chilopoda) AST C-like

MVSISSSSLPQAFTLLVLLVIAVTCTVQALDARTNDDESGPDVSRLQLSSDDVDPLRSYMLSRIVDDLQMVSSPQYQQRQERRAQEMTKRQIRFHQCYFNPVSCFRRRK*
>Hanseniella sp. (Symphyla) AST C1

MALLLRSILALLAVILALNQVSPVSTAAENDLHSYDHSNPTYHMIDDDGSLDTALINYLFAKQMIRRLQASADITDLQRKRTYWRQCAFNAVSCFGKK*
>Hanseniella sp. (Symphyla) AST C2

MALIVRSSLVVLAVIVAIHQVVGKSTSESESDVHGFGQEPGDRTTHLIDDDGSLDTALINYLFARQMIKRLQASADITDLQRKRTYWRQCAFNAVSCFGKK*
>Hanseniella sp. (Symphyla) AST CC

…KDLKDLKTKKKYWRQCAFNPVACFGNKSAGQGLNS*


>Hanseniella sp. (Symphyla) AST C-like1

MKSTVVQTVSPAVVCMTFAAVIAITLAGQTEAGSSPSASGAVDEILTEYPRPDAQEAEQMRTLLLHKLVNDLRTLSDQRGVGSARMSNTDHIENVKRQIRYHQCYFNPISCFRRRK*
>Hanseniella sp. (Symphyla) AST C-like2

MKTTVSNVSSLMLCVTLAITISLVQAGPSVGPAAPVSMEEILTDYPKDAQEAEQMRAMILQRLMDDLRRLSEQKNSASTRIGGSSDHIETVKRQIRYHQCYFNPISCFRRRK*
>Eudigraphis takakuwai nigricans (Diplopoda) AST C

MAFSNAFTLTCALSLLSAWTIASFFVSATSAKIAPRISAYPDEASVNEAxSFRSEPSGYTGDASGEQNSEEYRKLLFRKMVSMIHSLPKESAVIENGFALPRISPEYDYVANMGLAKRQTTYRQCYFNPVSCFGRRRK*

..............................................................................................

  1   2   3   4   5   6   7   8   9   ...   14


База данных защищена авторским правом ©shkola.of.by 2016
звярнуцца да адміністрацыі

    Галоўная старонка