1: af286230 hiv-1 strain 98CN009 from China, complete genome




Дата канвертавання25.04.2016
Памер38 Kb.
1: AF286230

HIV-1 strain 98CN009 from China, complete genome

PubMed, Protein, Related Sequences, Taxonomy

LOCUS AF286230 8978 bp DNA VRL 10-APR-2001

DEFINITION HIV-1 strain 98CN009 from China, complete genome.

ACCESSION AF286230

VERSION AF286230.1 GI:13569277

KEYWORDS .

SOURCE Human immunodeficiency virus type 1.

ORGANISM Human immunodeficiency virus type 1

Viruses; Retroid viruses; Retroviridae; Lentivirus; Primate

lentivirus group.

REFERENCE 1 (bases 1 to 8978)

AUTHORS Rodenburg,C.M., Li,Y., Trask,S.A., Chen,Y., Decker,J.,

Robertson,D.L., Kalish,M.L., Shaw,G.M., Allen,S., Hahn,B.H. and

Gao,F.


TITLE Near full-length clones and reference sequences for subtype C

isolates of HIV type 1 from three different continents

JOURNAL AIDS Res. Hum. Retroviruses 17 (2), 161-168 (2001)

MEDLINE 21094715

REFERENCE 2 (bases 1 to 8978)

AUTHORS Rodenburg,C.M., Li,Y., Trask,S.A., Chen,Y., Decker,J.,

Robertson,D.L., Allen,S., Shaw,G.M., Hahn,B.H. and Gao,F.

TITLE Direct Submission

JOURNAL Submitted (11-JUL-2000) Medicine, University of Alabama at

Birmingham, 701 19th Street, South, LHRB 641, Birmingham, AL 35294,

USA

FEATURES Location/Qualifiers



source 1..8978

/organism="Human immunodeficiency virus type 1"

/proviral

/strain="98CN009"

/db_xref="taxon:11676"

/country="China"

/note="isolated in 1998"

gene 137..1624

/gene="gag"

CDS 137..1624

/gene="gag"

/codon_start=1

/product="gag protein"

/protein_id="AAK31017.1"

/db_xref="GI:13569278"

/translation="MGARASILRGGKLDKWEKIRLRPGGKKHYMLKHLVWASRELERF

ALNPGLLETSEGCRQIMKQLQPALQTGTEELRSLFNTVATLYCVHTEIDVRDTKEALD

KIEEEQNKIQQKTQQAKEADGKVSQNYPIVQNLQGQMVHQALSPRTLNAWVKVVEEKA

FSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQILKDTINEEAAEWDRLHPVHAG

PIAPGQMREPRGSDIAGTTSNLQEQIAWMTSNPPVPVGDIYKRWIILGLNKIVRMYSP

TSILDIKQGPKEPFRDYVDRFFKTLRAEQATQDVKNWMTDTLLVQNANPDCKTILRAL

GPGASIEEMMTACQGVGGPSHKARVLAEAMSQTNSTILMQRSNFKGSKRIVKCFNCGK

EGHIARNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSHKGRPGNFLQSRPEP

TAPPEESFRFGEETTTPSQKQETIDKELYPLTSLKSLFGNDPSSQ"

gene <1417..4428

/gene="pol"

CDS <1417..4428

/gene="pol"

/codon_start=1

/product="pol polyprotein"

/protein_id="AAK31018.1"

/db_xref="GI:13569279"

/translation="FFRENLALPQGKAREFSSEQTRANSPTRGELQVWGRDNNSISEA

GDNRQGTISFNFPQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGKWKPKM

IGGIGGFIKVRQYEQIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNFPISPI

ETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPIFAI

KKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPLY

EDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIV

IYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPD

KWTVQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPL

TEEAELELAENREILKEPVHGIYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGK

YAKMRTAHTNDVKQLTEAVQKIAMESIVIWGKTPKFRLPIQKETWEIWWTDYWQATWI

PEWEFVNTPPLVKLWYQLEKDPIVGVETFYVDGAANRETKIGKAGYVTDRGRKKVVSL

TETTNQKTELHAICIALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIK

KERVYLSWVPAHKGIGGNEQVDKLVSSGIRKVLFLDGIDKAQEEHERYHSNWRAMASD

FNLPPVVAKEIVASCDQCQLKGEAMHGQVDCSPGIWQLDCTHLEGKIILVAVHVASGY

MEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSNFTSTAVKAACWWAGIQQEFGI

PYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGER

IIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPSWKGPAKLLWKGEGAVVIQDNSDI

KVVPRRKAKIIKDYGKQMAGADCVAGRQDED"

gene 4373..4954

/gene="vif"

CDS 4373..4954

/gene="vif"

/codon_start=1

/product="vif protein"

/protein_id="AAK31019.1"

/db_xref="GI:13569280"

/translation="MENRWQVLIVWQVDRMKIRTWNSLVKHHMYVSRRANGWFYRHHY

DSRHPKVSSEVHIPVGEAKLVIKTYWGLQTGERDWHLGHGVSIEWRLRRYTTQIEPGL

ADQLIHLYYFDCFADSAIRKAILGHIVIPRCDYQAGHNNKVGSLQYLALTALIKPKKI

KPPLPSIKKLVEDRWNNPQKIRGRRGNHTMNGH"

gene 4894..5184

/gene="vpr"

CDS 4894..5184

/gene="vpr"

/codon_start=1

/product="vpr protein"

/protein_id="AAK31020.1"

/db_xref="GI:13569281"

/translation="MEQSPEDQGPQREPYNEWTLELLEELKQEAVRHFPRPWLHSLGQ

HIYETYGDTWAGVEAIIRTLQQLLFIHFRIGCQHSRIGILRQRRTRNGASRS"

gene 5165..7791

/gene="tat"

CDS join(5165..5379,7701..7791)

/gene="tat"

/codon_start=1

/product="tat protein"

/protein_id="AAK31021.1"

/db_xref="GI:13569282"

/translation="MEPVDPKLESWKHPGSQPKTACTNCYCKKCCFHCQVCFMKKGLG

IFYGRKKRRQRRSAPQSSEDHQNLISKQPLPRTQGDPTGSEESKKKVESKTKTDPFD"

gene 5304..7948

/gene="rev"

CDS join(5304..5379,7701..7948)

/gene="rev"

/codon_start=1

/product="rev protein"

/protein_id="AAK31022.1"

/db_xref="GI:13569283"

/translation="MAGRSEDSDEALLKAVRTIKILYQSNPYPEPRGTRQARKNRRRR

WRARQRQIHSISERILSACLGRSAEPVPLQLPPIERLHISGSESGGTSGTQQSQGTTE

GVGSP"

gene 5396..5641



/gene="vpu"

CDS 5396..5641

/gene="vpu"

/codon_start=1

/product="vpu protein"

/protein_id="AAK31023.1"

/db_xref="GI:13569284"

/translation="MQTLTILAIVALVVAAIIAIVVWTIVLIEYRKILRQKRIDRLID

RIRERAEDSGNESDGDQEELSAFMEMGHHAPWDVDDL"

gene 5559..8138

/gene="env"

CDS 5559..8138

/gene="env"

/codon_start=1

/product="envelope glycoprotein"

/protein_id="AAK31024.1"

/db_xref="GI:13569285"

/translation="MRVTGIKKNYRHLWRWGTMLLGMLMICSAVGNLWVTVYYGVPVW

KEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEMFLENVTENFNMWKNEMVNQ

MHEDVISLWDQSLKPCVKLTPLCVTLECKNVSSNSNGTCNETCRESMKEMKNCSFNAT

TVVRDKKQTVYALFYRLDIVPFTKKNSSGNSSEHYRLINCNTSAITQACPKVTFDPIP

IHYCTPAGYAILKCNDRRFNGTGPCHNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIII

RSENLTNNVKTIIVHLNQSVEIVCTRPGNNTRKSIRIGPGQTFYATGEIIGDIRQAHC

NISEDKWNKTLQGVSEKLAEHFQNKTIKFASSSGGDLEITTHSFNCRGEFFYCNTSGL

FNGTYMPNDTKSNSSSIITIPCRIKQIINMWQEVGRAMYAPPIEGNITCKSNITGLLL

VRDGGTETNDTETFRPGGGDMRDNWRSELYKYKVVEIKPLGVAPTAAKRRVVEREKRA

VGIGAVFLGFLGAAGSTMGAASITLTVQARQLLSGIVQQQSNLLRAIEAQQHLLQLTV

WGIKQLQTRVLAIERYLKDQQLLGIWGCSGKLICTTAVPWNSSWSNKSQGEIWDNMTW

MQWDKEISNYTNTIYRLLEESQNQQERNEKDLLALDSWKNLWSWFDITNWLWYIKIFI

IIVGGLIGLRIIFAVLSIVNRVRQGYSPLSFQTLTPNPGGPDRLGRIEEEGGEQDKDR

SIRLVNGFLALAWDDLRNLCLFSYHRLRDFILVAARVVELLGRNSLRGLQRGWEALKY

LGSLVQYWGQELKKSTISLVDTIAIAVAEGTDRIIELVQGLCRAIYNIPRRIRQGFEA

ALQ"

gene 8140..8760



/gene="nef"

CDS 8140..8760

/gene="nef"

/codon_start=1

/product="nef protein"

/protein_id="AAK31025.1"

/db_xref="GI:13569286"

/translation="MGGKWSKSSIVGWPDIRERMRTEQPAADGVGAVSRDLEKHGAIT

SSNTPATNDDCAWLEAQEEKEVGFPVRPQVPLRPMTYKGALDLSFFLKEKGGLEGLIY

SRKRQEILDLWVYHTQGYFPDWHNYTPGPGVRFPLTFGWCFKLVPVDPREVEEANEGE

NNCLLHPVCQHGMEDEHREVLKWKFDSQLAHRHRARELHPEFYKDC"

BASE COUNT 3265 a 1564 c 2143 g 2006 t

ORIGIN

1 ttgaaagcga aagtaagacc agaggagatc tctcgacgca ggactcggct tgctgaagtg



61 cactcggcaa gaggcgagag cggcgactgg tgagtacgcc aattatattt gactagcgga

121 ggctagaagg agagagatgg gtgcgagagc gtcaatatta agagggggaa aattagataa

181 atgggaaaaa attaggttaa ggccaggggg aaagaagcac tatatgctaa aacacctagt

241 atgggcaagc agggagctgg aaagatttgc acttaatcct ggccttttag agacatcaga

301 aggctgtaga caaataatga aacagctaca accagctctt cagacaggaa cagaggaact

361 tagatcatta ttcaacacag tagcaactct ctattgtgta catacagaga tagatgtacg

421 agacaccaaa gaagccttag acaagataga ggaagaacaa aacaaaattc agcaaaaaac

481 acagcaggca aaggaggctg acgggaaggt cagtcaaaat tatcctatag tgcagaatct

541 ccaagggcaa atggtacatc aggccctatc acctagaact ttaaatgcat gggtaaaagt

601 ggtagaagag aaggctttta gcccagaagt catacccatg ttttcagcat tatcagaagg

661 agccacccca caagatttaa acaccatgct aaacacagtg gggggacatc aagcagccat

721 gcaaatatta aaagatacca tcaatgaaga ggctgcagaa tgggatagat tacatccagt

781 acatgcaggg cctattgcac caggccaaat gagagaacca aggggaagtg acatagcagg

841 aactactagt aaccttcagg aacaaatagc atggatgaca agtaacccac ctgttccagt

901 aggagacatc tataaaagat ggataattct gggattaaat aaaatagtaa gaatgtatag

961 ccctaccagc attctggaca taaaacaagg gccaaaggaa ccctttagag actatgtaga

1021 ccggttcttt aaaactttaa gagcggaaca agctacacaa gatgtaaaaa attggatgac

1081 agacaccttg ttggtccaaa atgcgaaccc agattgtaag accattttaa gagcattagg

1141 accaggggct tccatagaag aaatgatgac agcatgtcag ggagtgggag gacctagcca

1201 taaagcaaga gtgttggctg aggcaatgag ccaaacaaac agtaccatac tgatgcagag

1261 aagcaatttt aaaggctcta aaagaattgt taaatgtttc aactgtggca aggaagggca

1321 catagccaga aattgcaggg cccctaggaa aaagggctgt tggaaatgtg gaaaagaagg

1381 acaccaaatg aaagattgta ctgagagaca ggccaatttt ttagggaaaa tctggccctc

1441 ccacaaggga aggccaggga attttcttca gagcagacca gagccaacag ccccaccaga

1501 ggagagcttc aggtttgggg aagagacaac aactccatct cagaagcagg agacaataga

1561 caaggaacta tatcctttaa cttccctcaa atcactcttt ggcaacgacc cctcgtcaca

1621 ataaagatag gggggcaatt aaaggaagct ctattagata caggagcaga tgatacagta

1681 ttagaagaca tgaatttgcc agggaaatgg aaaccaaaaa tgataggggg aattggaggt

1741 tttatcaaag taagacagta tgaacagata cccatagaaa tctgcggaca caaagctata

1801 ggtacagtat tagtaggacc tacacctgtc aacataattg gaagaaatct gttgactcag

1861 cttggttgca ctttaaattt tccaatcagc cccattgaaa ctgtaccagt aaaattaaag

1921 ccaggaatgg atggcccaaa ggttaaacaa tggccattga cagaagagaa aataaaagca

1981 ttaacagcaa tttgtgatga aatggagaag gaaggaaaaa ttacaaaaat tgggcctgaa

2041 aatccatata acactccaat atttgccata aaaaagaagg acagtactaa gtggagaaaa

2101 ttagtagatt tcagggaact caataaaaga actcaagatt tttgggaagt ccaattagga

2161 ataccacacc cagcagggtt aaaaaggaaa aaatcagtga cagtactgga tgtgggggat

2221 gcatattttt cagttccttt atatgaagac ttcaggaaat atactgcatt caccatacct

2281 agtacaaaca atgaaacacc agggattagg tatcagtaca atgtacttcc acagggatgg

2341 aaaggatcac cagcaatatt ccaaagtagc atgacaaaaa tcttagagcc ttttagaaaa

2401 caaaatccag acatagttat ttatcaatac atggatgatt tgtatgtagg atctgactta

2461 gagatagggc agcatagaac aaaaatagag gaactgagac aacatttgtt gaggtgggga

2521 tttaccacac cagacaagaa acatcagaaa gaacctccat ttctttggat ggggtatgaa

2581 ctccatcctg acaaatggac agtacagcct atacagctgc cagaaaaaga tagctggact

2641 gtcaatgata tacaaaagtt agtgggaaaa ttaaactggg caagtcagat ttatcctgga

2701 attaaagtaa ggcaactttg taaactcctt aggggggcca aagcactaac agacatagta

2761 ccactaactg aagaagcaga attagaattg gcagaaaaca gggaaattct aaaagaacca

2821 gtacatggaa tatactatga cccatcaaaa gacttgatag ctgaaataca gaaacagggg

2881 caggaccaat ggacatatca aatttaccaa gaaccattca aaaatctaaa aacagggaag

2941 tatgcaaaaa tgaggactgc ccacactaat gatgtaaaac aattaacaga ggctgtgcag

3001 aaaatagcca tggaaagcat agtaatatgg ggaaagactc ctaaatttag attacccatc

3061 caaaaagaaa catgggagat atggtggaca gactattggc aagccacctg gattcctgag

3121 tgggaatttg ttaacacccc tcccttagta aaattatggt accagctgga aaaagatccc

3181 atagtaggag tagaaacttt ctatgtagat ggagcagcta atagggagac taaaatagga

3241 aaagcagggt atgttactga cagaggaagg aagaaagttg tttctctaac tgaaacaaca

3301 aatcagaaga ctgaattgca cgcaatttgt atagctttgc aagattcagg atcagaagta

3361 aacatagtaa cagattcaca gtatgcatta gggatcattc aagcacaacc agataagagt

3421 gaatcagagt tagttaacca aataatagaa caattaataa aaaaggaaag agtctacctg

3481 tcatgggtac cagcacataa aggaattgga ggaaatgaac aagtagataa attagtaagt

3541 agtggaatca ggaaagtgct atttctagat ggaatagata aagctcaaga agagcatgaa

3601 aggtatcaca gcaattggag agcaatggct agtgacttta atctgccacc cgtagtagca

3661 aaagaaatag tggctagctg tgatcaatgt cagctaaaag gagaagccat gcatggacaa

3721 gtagactgta gtccagggat atggcaatta gattgtacac atttagaagg aaaaatcatc

3781 ctggtagcag tccatgtagc cagtggctac atggaagcag aggttatccc agcagaaaca

3841 ggacaagaga cagcatactt tatactaaaa ttagcaggaa gatggccagt caaagtaata

3901 catacagaca atggtagtaa tttcaccagt actgcagtta aggcagcctg ttggtgggca

3961 ggtatccaac aggaatttgg aattccctac aatccccaaa gtcagggagt agtagaatcc

4021 atgaataaag aattaaagaa aattataggg caggtaagag atcaagctga gcaccttaag

4081 acagcagtac aaatggcagt attcattcac aattttaaaa gaaaaggggg gattgggggg

4141 tacagtgcag gggaaagaat aatagatata atagcaacag acatacaaac taaagaatta

4201 caaaaacaga ttacaaaaat tcaaaatttt cgggtttatt acagagacag cagagacccc

4261 agctggaaag gaccagccaa actactctgg aaaggtgaag gggcagtagt aatacaagat

4321 aatagtgaca taaaggtagt accaaggagg aaagcaaaaa tcattaagga ctatggaaaa

4381 cagatggcag gtgctgattg tgtggcaggt agacaggatg aagattagaa catggaatag

4441 tttagtaaaa caccatatgt atgtttcaag gagagctaat ggatggtttt acagacatca

4501 ttatgacagc agacatccaa aagtaagttc agaagtacac atcccagtag gagaggctaa

4561 attagtaata aaaacatatt gggggttgca aacaggagaa agagattggc atttgggtca

4621 tggagtctcc atagaatgga gattgagaag atataccaca caaatagaac ctggcctggc

4681 agaccagcta attcatttgt attattttga ttgttttgca gactctgcta taaggaaagc

4741 catattagga cacatagtta ttcctaggtg tgactatcaa gcaggacata ataataaggt

4801 aggatctcta caatacttgg cactgacagc attgataaaa ccaaaaaaga taaagccacc

4861 tctgcctagt attaagaaat tagtagagga tagatggaac aatccccaga agatcagggg

4921 ccgcagaggg aaccatacaa tgaatggaca ctagagcttc tagaggagct caagcaggaa

4981 gctgtcagac actttcctag accatggctt catagcttag gacaacatat ctatgaaaca

5041 tatggggata cttgggcagg agtggaagcc ataataagaa ctctgcaaca actgctgttt

5101 attcatttca gaattgggtg tcagcatagc agaataggca ttttgagaca gagaagaaca

5161 agaaatggag ccagtagatc ctaaattaga gtcttggaag catccaggaa gtcagcctaa

5221 gactgcttgt accaattgct attgtaaaaa gtgctgcttt cattgccaag tttgtttcat

5281 gaaaaaaggc ttaggcatct tctatggcag gaagaagcga agacagcgac gaagcgctcc

5341 tcaaagcagt gaggaccatc aaaatcttat atcaaagcag taagtagtac atgtaatgca

5401 aactttaacc attttagcaa tagtagcctt agtagtagcg gcaataatag caatagttgt

5461 gtggaccata gtactcatag aatataggaa aatattaaga cagaaaagaa tagacaggtt

5521 aattgataga ataagagaaa gagcagaaga cagtggcaat gagagtgacg gggatcaaga

5581 agaattatcg gcatttatgg agatggggca ccatgctcct tgggatgttg atgatctgta

5641 gtgctgtagg aaacttgtgg gtcacagtct attatggggt acctgtatgg aaagaggcaa

5701 ccaccacttt attttgtgca tcagatgcta aagcatatga tacagaggta cataatgttt

5761 gggctacaca tgcctgtgta cccacagacc ccaacccaca agaaatgttt ttggaaaatg

5821 taacagaaaa ttttaacatg tggaaaaatg aaatggtaaa tcagatgcat gaagatgtaa

5881 tcagtttatg ggatcaaagc ctaaagccat gtgtaaagtt gaccccactc tgtgtcactt

5941 tagagtgtaa aaatgttagc agtaatagta atggtacctg caatgagacc tgccgtgaga

6001 gcatgaagga aatgaaaaat tgctctttca atgcaaccac agtagtaaga gataagaagc

6061 agacagtgta tgcacttttt tatagacttg atatagtacc atttactaag aagaactcta

6121 gtgggaactc tagtgagcat tatagattaa taaattgtaa tacctcagcc ataacacaag

6181 cctgtccaaa ggtcactttt gatccaattc ctatacacta ttgcactcca gctggttatg

6241 caattctaaa gtgtaatgat aggagattca atgggacagg accatgccat aatgttagca

6301 cagtacaatg tacacatggg attaagccag tggtatcaac tcaactactg ttaaatggta

6361 gcctagcaga agaagaaata ataattagat ctgaaaatct gacaaacaat gtcaaaacaa

6421 taatagtaca tcttaatcaa tctgtagaaa ttgtatgtac aagacccggc aataatacaa

6481 gaaaaagtat aaggatagga ccaggacaaa cattctatgc aacaggagaa ataataggag

6541 acataagaca agcacattgt aacattagtg aagataaatg gaataaaact ctacaagggg

6601 taagtgaaaa attagcagaa cacttccaga ataaaacaat aaaatttgca tcatcctcag

6661 gaggggacct agaaattaca acacatagct ttaattgtag aggagaattt ttctattgta

6721 atacatcagg cctgtttaat ggtacataca tgcctaatga tacaaaaagt aattcaagct

6781 caatcatcac aatcccatgc agaataaagc aaattataaa tatgtggcag gaggtaggac

6841 gagcaatgta tgcccctccc attgaaggaa acataacatg taaatcaaat atcacaggac

6901 tactattggt acgtgatgga ggaacagaga caaatgatac agagacattc agacctggag

6961 gaggagatat gagggacaat tggagaagtg aattatataa atataaagtg gtagaaatta

7021 agccattggg agtagcaccc actgcagcaa aaaggagagt ggtggagaga gaaaaaagag

7081 cagtgggaat aggagctgtg ttccttgggt tcttgggagc agcaggaagc actatgggcg

7141 cggcgtcaat aacgctgacg gtacaggcca gacaattgtt gtctggtata gtgcaacagc

7201 aaagcaattt gctgagggct atagaggcgc aacagcatct gttgcaactc acggtctggg

7261 gcattaagca gctccagaca agagtcctgg ctatagaaag atacctaaag gatcaacagc

7321 tcctagggat ttggggctgc tctggaaaac tcatctgcac tactgctgta ccttggaact

7381 ccagttggag taacaaatct caaggagaga tttgggataa catgacctgg atgcaatggg

7441 ataaagaaat tagtaattac acaaacacaa tatacaggtt gcttgaagaa tcgcaaaacc

7501 agcaagaaag gaatgaaaaa gatctattag cattggacag ttggaaaaat ctatggagtt

7561 ggtttgacat aacaaattgg ctgtggtata taaaaatatt cataataata gtaggaggct

7621 tgataggttt aagaataatt tttgctgtgc tctctatagt gaatagagtt aggcagggat

7681 actcaccttt gtcgtttcag acccttaccc cgaacccagg gggacccgac aggctcggaa

7741 gaatcgaaga agaaggtgga gagcaagaca aagacagatc cattcgatta gtgaacggat

7801 tcttagcgct tgcctgggac gatctgcgga acctgtgcct cttcagctac caccgattga

7861 gagacttcat attagtggca gcgagagtgg tggaacttct gggacgcaac agtctcaggg

7921 gactacagag ggggtgggaa gcccttaaat atctgggaag tcttgtgcag tactggggtc

7981 aggagctaaa aaagagtact attagtctgg ttgataccat agcaatagca gtagctgaag

8041 gaacagatag gattatagaa ttagtacaag gactttgtag agctatctac aacataccta

8101 gaagaataag acagggcttt gaagcagctt tgcaataaaa tggggggcaa gtggtcgaaa

8161 agtagcatag ttggatggcc tgatataagg gagagaatga gaactgagca gccagcagca

8221 gatggggtgg gagcagtatc tcgggacctg gaaaaacatg gagcaatcac gagtagcaat

8281 acaccagcta ctaatgatga ttgtgcctgg ctggaagcgc aagaggagaa ggaggtaggt

8341 tttccagtca gacctcaggt acctttaaga ccaatgactt acaagggagc tctagatctt

8401 agcttctttt taaaagaaaa ggggggactg gaagggttaa tttactctag gaaaaggcaa

8461 gagatccttg atttgtgggt ctatcacaca caaggctact tccctgattg gcacaactac

8521 acaccaggac caggggtcag attcccactg acttttgggt ggtgcttcaa gctagtacca

8581 gttgacccaa gggaagtaga agaggccaac gaaggagaaa acaactgctt gttacaccct

8641 gtgtgccagc acggaatgga ggatgaacac agagaagtat taaaatggaa gtttgacagt

8701 caactagcac acagacacag ggcccgcgaa ctacatccgg agttttacaa agactgctga

8761 cacagaaggg actttccgcg gggactttcc actggggcgt tctaggaggt gtggtctggg

8821 cgggactggg agtggtcaac cctcagatgc tgcatataag cagctgcttt tcgcctgtac

8881 tgggtctctc tagtcagacc agatctgagc ctgggagctc tctggctaac tagggaaccc

8941 actgcttaag cctcaataaa gcttgccttg agtgcttc

//

Restrictions on Use | Write to the HelpDesk



NCBI | NLM | NIH


База данных защищена авторским правом ©shkola.of.by 2016
звярнуцца да адміністрацыі

    Галоўная старонка