If no accession number is given or only a partial protein sequence is found in the database then the protein sequence was derived from genomic sequence. Grey shading indicates genomes that are complete according to ncbi




старонка1/10
Дата канвертавання19.04.2016
Памер371.95 Kb.
  1   2   3   4   5   6   7   8   9   10
Fungal PAQRs
If no accession number is given or only a partial protein sequence is found in the database then the protein sequence was derived from genomic sequence. Grey shading indicates genomes that are complete according to NCBI.
Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; "Post-WGD yeasts"; Saccharomyces cerevisiae
> Saccharomyces cerevisiae (Izh1p) NCBI:NP_010780

MSITTTRRRNQDSVCCKATRASIKVEAVSGQTVFEKQKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMHSHIHP*
> Saccharomyces cerevisiae (Izh2p) NCBI:NP_014641

MSTLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVHIKMENGIVS*
> Saccharomyces cerevisiae (Izh3p) NCBI:NP_013123

MMDSSSKSLTQYIPSPMGSLSRLKQKGVDNFQKVKKSGKSIYNYNYSKFVPHPFSTIDESVKHSESGRYDDLEIIRPTKEKEVTSSVYKRNSGKSLNTESQFSLGDSDAATLVNSVATFKLNNASTSTSLVSSSSTVCSQAKSSLRSPTSRLNDTKIKEENNYISSVKDYCGPMRKSMVKTEILIEEPLNPTTDIKSFINSYNHGKAYSLGETQHLHYYQLPFPWRENRYIIHGYRFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAIYIIYLAIYDFPQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGITILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFLHLIFLTDLHYAATLFSPVTYKSVVWYLVGVVFYGSFIPERFRSDVQVDKTIPTNYELSTDLEIITKQREIHFREVPTAHSKCSSCPSHAKSFKSLWWVDYFGCSHTFWHFFVVLGVIGHYRAILDMFAKRWILS*


> Saccharomyces cerevisiae (Izh4p) NCBI:NP_014540

MVSLTTIEQSPVKCETTTEKESNDTRGTDSNENAETKETKKGFPFHDLAKLQKQYKNKSSRNESLVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFIYHFVKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLISSKRFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVNAITWELVALVAASIIYVTRFPESLFRRNKKEEGWNHSEYLFHLLISGTAFYHFFILIQSYILMHSSLNQPELINFKS*
Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; "Post-WGD yeasts"; Saccharomyces bayanus
> Saccharomyces bayanus (Izh1p) NCBI Genome

MSITATRRRNQENVCCKTSTSIKVEALKSKVTLRKEKLLHDFHELPDWQRDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFGVTLTNYFLIPVFPSTTWSDYTVINIFLMGAFLCLMCSSCFHCMKQHSEKQSDFWSKLDYLGIISLISCSMIPIIYFGYFDHASYFSLFTIVTLVLATFCTICVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGLFKFGLQGVLNRIRVSFVFWEALFYISGALIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMHSHFHS*


> Saccharomyces bayanus (Izh2p) NCBI Genome

MSTLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVHIKMQNGIVS*


> Saccharomyces bayanus (Izh3p) NCBI Genome

MDSSSRNLTQYLPSPMESLSRLKRKGVDNFHKVKKSGKSIYNYNYSKFVPHPFSTIDETIKHSESDHDDHLESIDAPKRSKAESVIYKRTVGKSLRAESQLSLGDSDALTLVNSTSTFKLNSASTSTSLVSSSSTICSKTRTSSRSSTSFPNQPKIREERGHFSNVKEYCGPMKKSMRQTKILIEEPLNPTTDIKSYISSYNHSKAHSLGENQHLHYYQLPFPWRENRYIIHGYRFYNTHYKSLLSVINWYGWHNETSNIWTHLLGAMYIVYLAVYDFPHSEVWQNPEVPQQARWIVFAFLAAALKCMLSSVFWHTFNGTSFLGLRSKFACVDYSGITILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFLHLIFLTDLHYAIWLFSPVTNKSVVWYLVGVVFYGSFIPERFRSDVQVDMTIPTDYELSTDLEIITKQKEIHFRKAPTTHSKCKACPSHAKSFKSLWWVDYVGCSHTFWHFFVVLGVIGHYKAILDMFTKRWAL*


> Saccharomyces bayanus (Izh4p) NCBI Genome

MASLTTVEQSPVEPKTATEKYSDATGAVTSNADVETKETKKGFPFHDLAKWQKQYKNKSSRSESLVALIYLLGSMSSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMIHFIYHFIKNISLQQHIEIWQKFSYLANINLLISSQITILYYLFYDYVFFFKIFTLLMTFIGLAAYFVILTDKLNSYKRFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKDRIKLNAITWELVTLVVASMIYVTRFPESLCRRNEKEEGWNHSEYFFHLLISGTAFYHFFILIQSYILMHSSLNQPELINFKS*


Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; "Post-WGD yeasts"; Saccharomyces kudriavzevii
> Saccharomyces kudriavzevii (Izh1p) NCBI Genome

MSITTTRRRNQESVCCKATTASIKVEAVQSKTASEKEKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLRSLFYWNNETVNIYTHLVPAIIYFLFAITLTNYFLIQIFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCLKQHSEEQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHVSYFSLFTTVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETIAPGKFDFLGSSHQIFHIMVVLGSLCHLKAIIDSYKLMHSHIHP*


> Saccharomyces kudriavzevii (Izh2p) NCBI Genome

MSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGLLNSYELVHLKMEGKIVS*


> Saccharomyces kudriavzevii (Izh3p) NCBI Genome

MESSSRSLTQYIPSPMESLSRLKRKGVDNFQKVKKSGKSIYNYNYSKFVPHSFSAIDENIKHSENDNDDVLEIIGSRKEKKVSKAIYKRKGGQSPSEVSQLSLGDSDAVTLVNSVSNLKLNNASTSTSLVSSSSTVCSQTKISSRSSRSFSNQAKIKEENPYFSNVKDYCGPMKASMIKREILIEEPLNPTTDIKSFINSYNHSEAYSLGESQHLHYYQLPFPWRENRYIIHGYRFYNTHSKSLLSIINWYGWHNETSNIWSHLLGAMYIIYLAIYDFPQSEVWRNPNVPQQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLRLRSKFACVDYSGITILITASILTTEFVTMYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFLHLIFLTDIYYASRLFGPVTYKSVVWYLVGVVFYGSFIPERFRSDVQVDKTIPTDYELSTDLEIITKQKEIHFRKVPTAHSKCNSCPSHVRSFKSLWWVDYVGCSHTFWHFFVVLGVIGHYKAILDMFARRWVLS*


> Saccharomyces kudriavzevii (Izh4p) NCBI Genome

MASLTTVEQSPAKCKTTTEKGNGTGETTNSNVDAETKEIKKGFPFHDLAKWQQQYRNKSSRNESLVALIYLLGSMSSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFVYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLNSSKRFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVKAITCELVALVAASIIYVTRFPESLFRRNKKEESWNHSEYLFHLVISGTAFYHFFILIQSYILMHSSLNQPELINFKS*


Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; "Post-WGD yeasts"; Saccharomyces mikatae
> Saccharomyces mikatae (Izh1p) NCBI Genome

MSLTTTRRRNQESVCCSVTTGSIKVEAVSSTTVSEKKKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAVIYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFLGSSHQIFHIMVVLGSICHLKAIIGSYKLMHSHIHP*


> Saccharomyces mikatae (Izh2p) NCBI Genome

MSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVV IASLCHLRGL LNSYELVHIK MESGIIS*


> Saccharomyces mikatae (Izh3p) NCBI Genome

MMDSSSRSLTQYIPSPMGSLSRLKRKGVYNFQRVKKSGKSIYNYNYSKFVSHPFSVTDENIKHSENGHYDDLEIIGPAKEKNVASAIYKRNNSKSSNVESQFSLGDSDAVTLVNSVSTFKLNNASTSTSLVSSSSTVCSQSKPSSRSSRSYSVQTETNEENRCFSNVKDYCGPVKKSMIKTEIYIEEPLNPTTDIKSFINSYNHGKAHILGESKHLHYYQLPFPWRENRYIIHGYRFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAMYLIYLAIYDFPQSEVWKNPKVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGITILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFLHLIFLTDLRYAARLFSPVTYKSVVWYLVGVAFYGSFIPERFRSDVQVDKTIPTNYELSTDLEIITKQREIHFRRAPTAHTKCKSCPSHAKSFKSLWWVDYVGCSHTFWHFFVVLGVIGHYRAILDMFAKRWVLS*


> Saccharomyces mikatae (Izh4p) NCBI Genome

MASLTTVEQSPAKCNTTPEKCNNSTAEINSTVGAKTKETKKGFPFHDLAKWQEQYKNKSSRNESVVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFIYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLISSKRFNKTVFFISVSVICCSLPLLTAIITFDGLENLKERIKVNAITWELVALVAASIIYVTRFPELFLRGKKKEEGWNHSEYLFHLIISGAAFYHFFILIQSYILMHSSLNQPELINFKS*


Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; "Post-WGD yeasts"; Saccharomyces paradoxus
> Saccharomyces paradoxus (Izh1p) NCBI Genome

MSITTTRRRNQDSVCCKATTASIKVEAVSDKTAFGKQKMLHNFDELPEWQKDNDKILTGYVRETLSWKKCLHSLFYWNNETVNIYTHLVPAIIYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEEQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTICVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMHSHIHP*


> Saccharomyces paradoxus (Izh2p) NCBI Genome

MSTLLERTKSVQELKKRAAGNTSANPAEVTEAKKVLKRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWQDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYYEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQIFHFLVVIAAFCHLRGLLNSYELVHMKMENGIVS*


> Saccharomyces paradoxus (Izh3p) NCBI Genome

MMDPSSKSLTQYIPSPMGSLSRLKRKGVDNFQKVKKSSKSIYNYNYSKFVPHPFSAIDESIKHSENGLFDDLEIIDSPKEKKVTSSVYKRNSGKSLNAESQFSLGDSDAVTLVNSVSTFKLNNASTSTSLVSSSSTVCSQVKSSSRSSTNHSIQTRIKEENDYISSVKDYCGPVKKSMIKTEILIEEPLNPTTDIKSFINSYNHGKAYNLGETQHLHYYQLPFPWRENRYIIHGYRFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAMYIIYLAIFDFPQSEVWQNSQVPSQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLNLRSKFACVDYSGITILITASILTTEFVTMYSCYWAMCTYMSISLALGVFGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFLHLIFLTDLRYAARLFSPVTYKSVVWYLVGVVFYGSFIPERFRSDVQVDKTIPTNYELSTDLEIITKQREIHFRKVPTAHSKCKSCPSHAKSFKSLWWVDYFGCSHTFWHFFVVLGVIGHYRAILDMFAKRWVLS*


> Saccharomyces paradoxus (Izh4p) NCBI Genome

MASLTTVEQGPAKCKATTGKDSNDTRETNPNVDAETKETKKGFPFHDLAKLQKQYKNKSSRNESLVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFVYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLISSKRFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVDAITWELVALVSASIIYVTRFPESLFRRNKKEEGWNHSEYLFHLVISGTAFYHFFILIQSYILMHSSLNQPELINFKS*


Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; "Post-WGD yeasts"; Saccharomyces pastorianus
> Saccharomyces pastorianus (Izh1pA) NCBI Genome

MSITTTRRRNQDSVCCKATRASIKVEAVSGQTVFEKQKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMHSHIHP*


> Saccharomyces pastorianus (Izh1pB) NCBI Genome

MSITATRRRNQETVCCKTTTTSIKVEALNSKATLRKEKLLHDFHELPDWQRDNDKILTGYVRETLSWKKCLYSMFYWNNETVNIYTHLVPAIVYFVFGVTLTNYFLIPVFPSTTWSDYTVINIFLMGAFLCLMCSSCFHCMKQHSEKQSDFWSKLDYLGIISLISCSMIPIIYFGYFDHVSYFSLFTVVTLVLATFCTICVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGLFKFGLQGVLNRIRVSFVFWEALFYISGALIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKVIIDSYKLMHSHFHS*


> Saccharomyces pastorianus (Izh2pA) NCBI Genome

MSTLLERTKSVQELKKRAAGNTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIGCSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVHIKMENGIVS*


> Saccharomyces pastorianus (Izh2pB) NCBI Genome

MSTLLERTNSVQELKKRAAGNTSANPAEVAEAKKVLKRVYSWDEIPEWQRDNDFILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETTTWLDHMMIDLFFSGAFACLILSSSFHCFKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPVFCLFALITLSFGVACSVVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGGLYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIAALCHMRGVLNSYELVHIKMQNGIVS*


> Saccharomyces pastorianus (Izh3pB) NCBI Genome

MDSSSRNLTQYLPSPMESLSRLKRKGVDNFHKVKKSGKSIYNYNYSKFVPHPFSTIDETIKHSESDHDDHLETIETLKGKKVESSIYKRTVGKSLRAESQLSLGDPDALTLVNSTSTFKLNSASTSTSLVSSSSTICSKTRTSSRSLTSFSNQLKIREECGHFSNVKEYCGPMKKSMRQTKILIEEPLNPTTDIKSYISSYNHSKAHNLGENQHLHYYQLPFPWRENRYIIHGYRFYNTHSKSLLSIINWYGWHNETSNIWTHLLGAMYIVYLAVYDFPQSEVWQNPKVPQQARWIVFAFLAAALKCMLSSVFWHTFNGTSFLGLRSKFACVDYSGITILITASILTTEFVTMYSCYWAMCIYMSISLALGVFGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFLHLIFLTDLHYAIWLFSPVTNKSVVWYLVGVVFYGSFIPERFRSDVQVDMTIPTDYELSTDLEIITKQKEIHFRKAPTTHSKCKSCPSHAKSFKSLWWVDYVGCSHTFWHFFVVLGVIGHYRAILDMFTKRWALS*


> Saccharomyces pastorianus (Izh3pA) NCBI Genome

FQKVKKSGKSIYNYNYSKFVPHLFSTIDESVKHSESGRYDDLEIIRPTKEKEGTSSVYKRNNGKSLNTESQFSLGDSDAATLVNSVATFKLNNASTSTSLVSSSSTVCSQAKSSLRSPTSRLNDTKIKEENNYISSVKDYCGPMRKSMVKTEILIEEPLNPTTDIKSFINSYNHGKAYSLGETQHLHYYQLPFPWRENRYIIHGYRFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAIYIIYLAIYDFPQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGITILITASILTTEFVTMYSCYWAMCTYMGISLALGVFGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFLHLIFLTDLHYAATLFSPVTYKSVVWYLVGVVFYGSFIPERFRSDVQVDKTIPTNYELSTDLEIITKQREIHFREVPTAHSKCSSCPSHAKSFKSLWWVDYFGCSHTFWHFFVVLGVIGHYRAILDMFAKRWILS*


> Saccharomyces pastorianus (Izh4pA) NCBI Genome

MVSLTTIEQSPVKCETTTEKESNDTRGTDSNENAETKETKKGFPFHDLAKLQKQYKNKSSRNESLVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFIYHFVKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLISSKRFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVNAITWELVTLVVASMIYVTRFPESLFRRNEKGEGWNHSEYLFHLLISGTAFYHFFILIQSYILMHSSLNQPELINFKS*


> Saccharomyces pastorianus (Izh4pB) NCBI Genome

MASLTTVERSPVKTATEKYSDATGEVTSNTDAETKETKKGFAFQDLAKWQKQYKNKSSRSESLVALIYLLGSMSSFCLLIFFTDFYLIPLFPTTTTMTDYIIFNFYLLNVFVFCMIHFIYHFIKNISLQQHLEHWQKFSYLANINLLISSQITILYYLFYDYVFFFKIFTLLMTFIGLAAYFVILTDKLNSYKRFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKDRIKLNAITWELVTLVVASMIYVTRFPESLFRRNEKGEGWNHSEYLFHLLISGTAFYHFFILIQSYILMHSSLNQPELINFKS*


Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceas; Saccharomyces complex; "Post-WGD yeasts"; Naumovozyma; Naumovozyma castellii (aka Saccharomyces castellii)
> Naumovozyma castellii (Izh1p) NCBI Genome

MSRVTTTRRKPTKVQAVAVGSSNKHADGDKTKRNWKRRLFNFNELPEWQRDNDKILTGYVRETKSFKQCLQSLLYWNNETINIYTHLIPALFYLTISVTLINYVVVPHFPTTSIMDYFVINVFLMGAFVCLILSSCFHCLKQHSSRQCTLWSKLDYMGIIILISCSLIPMIYFGYFDHLYYVNFFIILTFSFATLCSICVLNEKFNVPHYRPFRAIVFMLFSFSGFIPILTGFYLFGFHGVFERVALKFVAWEALFYITGATLYGFRIPECFKPGDFDFLGSSHQIFHILVVLGSICHFRAVIKSYILMHSSMN*


> Naumovozyma castellii (Izh2p) NCBI Genome

MTKNLQQRVALTSTSTSTKTTIDDDNVSIKHTKKTTTIRKLYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTMLFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL*


> Naumovozyma castellii (Izh3p) NCBI Genome

MTVQGSRADCAYSTKMVTNVLPTALDSLSRLKKKGMSNVNRVRKSGRDLASRYGYSRFMANPFAATEHDKEIVYDPTIPENENLKLLSKMESSNDFIPNMEHHKLISRSNSANDLGSQVSLNSEAQTLVNAFSSTNSSLFKTSRQGSSPYSNPIAASSTSLFSAPTRVSSTVFNEEFKLDVVTEYQPLTKPSEEVKNLICSYNHEVAYEIGKTEHLNYYQLPFPWRENRYIIYNYRFYDSHKKSLLSIFNWYGWHNETSNIWTHLIGGLYLIYMAVYDFPRSEIFLSDKIPTTAKLIVYLFLFAAIKCLFASVFWHSFNGTCTLKLRSKFACVDYSGISILITASILTTEFVTLYSSYRAMCVYMAISLSLGIFGVFMNWSPKFDRPEARPLRIKFFVLLASMGVLSFLHLTFLTDWKYATWLLAPVTNKSIVWYCIGVVFYGSFIPERFRSDVQVDPTIPTTFQLSTDLNIITKDKNIHFRSEPVVNEEVHNCKEHWKSFKSLWWVDYVGCSHTFWHFFVVLGIIGHYRAIIDMFTKRWLLA*


> Naumovozyma castellii (Izh4p) NCBI Genome

MATLTSTTKKQTATEIQDADKLTPFNAPKYSVTFPRRPKVLPILKELPQWQKQYSNSKIINGYVRETNSLIKCLHTVTYWNNQTVNIILNTVFSTVYFTLLLFFTDLYLIPSSPATTMSDYIMVNFYLFGAFQYLALNSIFYLLESHSLAKCHLWFKLSHLAFINYISTSIITQLYYTFFDNVFYFKFLTISTLLISSIFAIFTLSEQFLRKNRSQRNMVSITFIVSLLILPTASLMFKFNTFRILRRVEGKAILLELSLYLFSMTLKAVQVPERFSENFDFIGNSENIYHICIILGSLLHFKMLLNSYFFMHSGLDASNLVTFNV*


Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; "Post-WGD yeasts"; Nakaseomyces; mitosporic Nakaseomyces; Candida glabrata
> Candida glabrata (Izh1p) NCBI:XP_446561

MSATTTLRKRASKSVGESGGRNDGSIHAHGEEKSEKLLWHFNELPEWQKDNDKILRGYVRETNSFKRCLQSLLYLNNESVNIYTHLIPAVFYISLSLYLANVFLIPVYPSTSSVDYVIINVFFLGAFFCLLCSSCFHCMKQHSESQCNVWSKLDYLGIICLISCSTVPMIYYGYFDHISEFTIFTGITLLLAIGCSVFVLTDKFNTTEYRPIRASFFTLFGFSGIIPLGAGFLKFGAEGVLQRISLPFIGLEALFYISGAIIYGFRFPETIAPGKFDFFGSSHQIFHIMVVLGSICHLFAMVESYHLIHSNFLRPV*
> Candida glabrata (Izh2p) NCBI:XP_445799

MGDVHQRKVATMVTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPTYSTTTLIDYLIIDIFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVHYRFMIDMY*
> Candida glabrata (Izh3p) NCBI:XP_445561

MDSISSASKHVSQYFDFEPSLHKWKQRGLDNIHRVRQTGRNVRYPRFIHNTWNSLTSYTDELRAPDNDAKARSQGQNKVTRPARSRAPKKNRYSESTISLTSDANTLVNSNASTTSFSRFRAPKPATTSNSFGSVGSGGSSPNDYSSTTSLSSAATPVPEELLEYVEKPVYTLTFKDDDVVVKEEEIIEELDIKTYINTYNYENAFEFGKVRHLHYYELPFPWRENRCIINGYRFYNSHKKSLLSIVNWYGWHNETSNIWTHLLGGLYILYLMFYQFPSSEVFMSEQVPKAAKLITYVFLIAAAKCLFSSVFWHTFNGTSLLRLRCKFACVDYSGISILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEARPLRIKFFILLASMGILSFLHLTFITSLSHSTWLLSPITKKSVVWYLVGVVFYGSFIPERWRTDIQYDHTIPTSHELSTNVDIINKEKHIHFRETPTPHEMCKHHEHHHRSFKSLWWVDYVGCSHTLWHFFVVLGVIGHYRAILDILTKKWILSGSPL*
> Candida glabrata (Izh4p) NCBI:XP_447574

MEKKTVQSKIVTLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYMNLVCGLISGVMLLFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLGQLLKGHSEYQGKLWNQAKQLALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIVIINDQYKRVQKLSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSAMLQLTRLPELTLSTLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVHASIHVPPMISFK*
Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; "Post-WGD yeasts"; Vanderwaltozyma; Vanderwaltozyma polyspora (aka Kluyveromyces polysporus)
> Vanderwaltozyma polyspora (Izh1p) NCBI:XP_001644147

MAHIATVEREYSSVSKRRTSKSANGTVTIEVEREEHEEIKLCHFHELPDWQKDNEFILTGYVRETNSIKKCLRSLGCFNNESINIYSHLIAAISYFVVLLFYTDILCIPSFPSTTFVDYMVIDLYLLGAFTCLIGSSLFHCMKQHSESHSDMWSKVDYIGIICLITCSLISLLYYGYMDHFIYFKVFTVITLVLATICTICVLDQRFNSKNFRPIRAGFFILFSMSAVIPIGAGFSKFGFTEVLQRIQLRFVAWETFFYVVGALLYGFRIPETLYPGNFDLVGSSHQIFHIMVILGSVFHLKAVLGSYTFMHSNISSNSFTLSS*
> Vanderwaltozyma polyspora (Izh2p) NCBI:XP_001646275

MVSQNIRRRSITSTSSTVTTVQVEKDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYLGIVVLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSSLTQ*
> Vanderwaltozyma polyspora (Izh3p) NCBI:XP_001646881

MESSTACSSMLTSENDEGSLNSSYSKKMADAVISSTSYSLDSISRLKRKSIDLVKKKSNEYISIGSGGSTVTNETFANLDNDGSNGSSTTISASLMNRLNRVKEKHLWRSNIKNSADTNKGTGAKNGNVKGIKVVDDEMLLLSRLSQDTLNNDSTFPLKTIAKLDSDVYSQFSDSNITLTNSVINTDMDKNINSLDNTPREPASKNSIHELLDEEHMWISEAMAENDNDLTYVIKSYNHSIAYDLGQDKHLHYYQLPFPWRENRYIINGYRFYHKNSKLLLSVFNWYGFHNETANIWSHLLGAIYFAYIVLFEFPKSFIVQSPEVPPSAKYIVYLFLLAGIKCMLASVFWHTFNGTCSIKLRPKYCCVDYSGITILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARPLRIKFFILLAALGGLAFFHVAYLEGMAYAAWLYSPVTSKSIVWYLIGVFFYGSFIPERFRSDFVIDKSIPNSKQLASDVTIITKHKHVHFREEPTKTNHCKDCTSKSFKTLWWVDYICNSHNIWHVFVFLGVMGHYNAILDMFAKKWLTNI*
Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; Pre-WGD yeasts; Zygosaccharomyces; Zygosaccharomyces rouxii
> Zygosaccharomyces rouxii (Izh1p) NCBI:XP_002495237

MSSITEVKRRRVPIGNGNGEGLYKEVLEEKTLYDFHELPEWQQDNDKILTGYIRETKSVLKCVRSLFIWNNETVNIYTHLVSAVSYFLLMLGITDLVMVPHFPTSTFTDYSVINFYLLGAFGCLMCSSCFHTFKQHSGPHSDAWSKVDYMGIIVLITCSMISLIYYGFFDHMEYFRLFTVLTLTLATACTVCVLSDKFNHKDFRPLRAGFFIAFGLSGVFPVAAGIIKFGIQGGVQRVQLKYLGLEAIFYIAGALIYGFRIPETMFPGRFDFWGHSHQIFHVLVVIASFLHLKAVMGSYIFKHSHLNGVGLAALQSTY*
> Zygosaccharomyces rouxii (Izh2p) NCBI:XP_002495978

MSNLKKRSSLSTTTSDSQTNLEVNQEQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNLLSNST*
> Zygosaccharomyces rouxii (Izh3p) NCBI:XP_002495407

MQSEAPLSSLRPINFNTIHKLRRRVKIGSVSVFNNKYCNAISNAIGRGHNGKDKNKDDEKEDEKNEAEAEGEDKDEEEDDFYDQDERKPFARSSTPEYLLSQKVKNTYKNGRLRDSKSITPNDSNISLLSEANTLVGSSTVVNENNSDENNGGRLSWSLNSSSSSPTVHSSSITSGGELCSTDVKTYIRNFNHSAAYQLGHKCHLHYYQLPFPYRENKYIIHGYRFYASHKKSFLSIINWYGWHNETSNIWTHLLGGLYLIYLAFYHFPHSNIWLSDRVPKPAKCIVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFACVDYTGITILITASILTVEFVTMYDYKISLLFYMICSLALGIIGVSMNWSPKFDRPEARPLRIKFFILLATVGCSSFIRLVFLTNWRYAADLLTPLTNKSVVWYLIGVFFYGSFIPERFRTDILTDKSIPTEKQLSTDLDIVTKHRDIHFREKPTIHPRSQCCQHHAGSFKSLWWVDYVGCSHTLWHFFVLLGVIGHYNAIMDMFTKRWIL*
Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; Pre-WGD yeasts; Lachancea; Lanchancea kluyveri (formerly Saccharomyces kluyveri)
> Lachancea kluyveri (Izh1p) NCBI Genome

MSSTTTVRQRRKTTQKASAESIATAKGRKRLCTFEELPDWQKDNELILDGYVRETRSVSECFKSLLYFHNETVNIYTHLVPGVTYLLMLMFLTDFILIPKFPSSTMTDYIIINFFLLGAFVCLMCSSCFHCLKQHSEEHSDIWSKVDYMGIIVLISCSMVSILYYGFHDHLFHFKIFTVVTVILGSCCAAFVLNDRFNSKNFRVFRASFFVSFGFSGLVPIIFGLVKFGISESVHRVQLKYVGLEAVFYIGGAVFYGFRIPENFGPGKFDLVGHSHQIFHVMVVLGSLCHLRAVVGSYIFMHTGVNYPGFLVFK*


> Lachancea kluyveri (Izh2p) NCBI Genome

MSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKLASI*


> Lachancea kluyveri (Izh3p) NCBI Genome

MERKEKDLEAVALNRLDKFINSLDHKLEKLEAMLPSSTSASGLPTPNLNRLKQRGKKFVRWGMNQVRDAPPPVQPEKQGAPHQQEEEVTTLYKFLKSTTEEFNGKETTPLESDTATLVGSNSSISLIRFSKIWHDHFNSGGNSNNGTVVHNSSSASFHSSSSTLITTSPERPNSPPSSRKSSSSVATEDVLQSLDYLDEKLETLIQDPGSIGQTIQLFNYDVAFKTGLSRHLHYYELPFPWRENRFIIHGYRFYHSHTKSLLSILNWYGWHNETTNIWTHLFGSLYIAYLAFYEFPQSSVYLSGDVPQFAKYMVYLFLGAGFKCLVSSVTWHTFNGTCKLHLRSKFACMDYTGITVLITASIMTAEFVSLYGNGDNPNSPVTFSLIFYMAVSSVLCCFGVFMNWSPRFDRPESRPLRIAFYLLLAGMGFLAFLHLTLITNFAHSSWLIRPVLDKSVCWYLIGVIFYGSFIPERWRSDILVDKCIPTHEELSKNLEIITTHKHIHFRENPTKHNHSVHKKSFRSLWWVDYYCCSHTLWHLFVLLGVVGHYRAVLDMFEKKWLSS*


Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; Pre-WGD yeasts; Lachancea; Lanchancea thermotolerans (formerly Kluyveromyces thermotolerans)
> Lachancea thermotolerans (Izh1p) NCBI:XP_002552634

MSSTYTLRQRRQQCAPNKGKAGTSGATAPGKNGLCCFEELPDWQRDNDKILAGYVRETNSMKKCFESLTYFHNETVNIYTHLIPSGTYLVMLMFFTDLFLIPQFPTTTMSDYIMINFFLLGAFLCLMCSTCFHCLKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFYDYLFHFKMFTIAVVVLGSCCAAFVLNDRFNAKNWRACRAGFFVTFGFSGIVPIVVGLVKFGIAESSKRVQLRFVLLEALFYISGAVIYGFRIPETLLPGKFDFVGHSHQIFHILVVLGSLCHFRALLGSYFFMHTGISSPGLLNLKAL*
> Lachancea thermotolerans (Izh2p) NCBI:XP_002552697

MEQGGLTQRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFHHVKVV*
> Lachancea thermotolerans (Izh3p) NCBI:XP_002551941

MDRLESLLPNDGAYRPRLHKLRTRGKQIVRWSKSQVAGVPAYALRKITWGAASEADEDAGDDARAAAAEPPTELFAADFDAITMVDSRPQSMLNSYRMKDAQTARWHAKTATAAAAMASGVSYVSSAATLVSSSSFSSAENISLSLPSASPARSLSSADSCGTSPVSPVAGLRICDAKAIEKSFQSIQNDAEAVAASIKFHNYEVALQLGQQRHLHYYELPFPWRENRFIIHGYRFYNSYSKSLLSIFNWYGWHNETVNIWTHLCGALYFAFLIFKGFSQTTVYQSELVPTAAKFMAFVFLTAGLECFLFSVVWHTFNGICHLKQRSNCACVDYTGITVLVTASILTTEFVTLSGSSDATFTWSLLFFTGASAALGAVGVFMNWSPKFDRPESRPLRIAFYLLLASFGFFSYLHSRLFNTAVDSSDLIKPVFMKSLAWYIIGVVFYGTFIPERWRSDVQVDANIPTEEQLTTDLEIITKHRHIHFRSQPASHHKCKNADHKRSFKSLWWVDYFCCSHTLWHLFVLLGVIGHYTAMLEMFEKRWLRG*
Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; Pre-WGD yeasts; Lachancea; Lanchancea waltii (aka Kluyveromyces waltii)
  1   2   3   4   5   6   7   8   9   10


База данных защищена авторским правом ©shkola.of.by 2016
звярнуцца да адміністрацыі

    Галоўная старонка