At5g15400. 1 68418. m01802 u-box domain-containing protein contains Pfam profile pf04564: u-box domain




Дата канвертавання25.04.2016
Памер60.03 Kb.
>At3g07370.1 68416.m00879 tetratricopeptide repeat (TPR)-containing protein / U-box domain-containing protein similar to serologically defined colon cancer antigen 7 GB:5031963 GI:3170178 [Homo sapiens];

MVTGVASAMAERLKEDGNNCFKKERFGAAIDAYTEAIALSPNVPAYWTNRALCHMKRKDWTKVEEDCRKAIQLVHNSVKAHYMLGLALLQKKEFTNGVKELQRALDLGRCSNPTGYMVEEIWEELSKAKYMEWELVSAMRSWELNSLKETCEAALNQQRALDMSRTEESSDEAYTAHTERLKALERVFKKAAEEDKPTEVPDYLCCNITLEIFRDPVISPSGVTYERAAILEHLKKVGKFDPITREKIDPANLVPNLAIKEAVAAYLEKHVWAYKMGC

>At3g54790.1 68416.m06063 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain

MDPVPVRCLLNSISRYLHLVACQTIRFNPIQTCIGNMVLLLKLLKPLLDEVVDCKIPSDDCLYKGCEDLDSVVNQAREFLEDWSPKLSKLFGVFQCEVLLGKVQTCSLEISRILLQLSQSSPVTSSVQSVERCVQETESFKQEGTLMELMENALRNQKDDITSLDNNHLESIIQMLGLISNQDLLKESITVEKERIRSQASKSEEDMEQTEQLIELVLCIREHMLKTEFLEVAKGISIPPYFRCPLSTELMLDPVIVASGQTFDRTSIKKWLDNGLAVCPRTRQVLTHQELIPNYTVKAMIASWLEANRINLATNSCHQYDGGDASSMANNMGSQDFNRTESFRFSLRSSSLTSRSSLETGNGFEKLKINVSASLCGESQSKDLEIFELLSPGQSYTHSRSESVCSVVSSVDYVPSVTHETESILGNHQSSSEMSPKKNLESSNNVNHEHSAAKTYECSVHDLDDSGTMTTSHTIKLVEDLKSGSNKVKTAAAAEIRHLTINSIENRVHIGRCGAITPLLSLLYSEEKLTQEHAVTALLNLSISELNKAMIVEVGAIEPLVHVLNTGNDRAKENSAASLFSLSVLQVNRERIGQSNAAIQALVNLLGKGTFRGKKDAASALFNLSITHDNKARIVQAKAVKYLVELLDPDLEMVDKAVALLANLSAVGEGRQAIVREGGIPLLVETVDLGSQRGKENAASVLLQLCLNSPKFCTLVLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDARMKKGRS

>At5g15400.1 68418.m01802 U-box domain-containing protein contains Pfam profile PF04564: U-box domain

MATSKPQRSPAEIEDIILRKIFYVTLTESTDSDPRIVYLEMTAAEILSEGKELLLSRDLMERVLIDRLSGDFSDAEPPFPYLIGCHRRAYDESKKIQSMKDKNLRSEMEIVTKQAKKLAVSYCRIHLGNPDMFGNSDKPSGGLDNRLKKRNVSPVLPLIFAEVGSGSLDMFGASSSGVQAPPGFLDEFFKDSDFDSLDSILKELYEDLRSTVINVSVLGDFQPPLRALKYLVSLPVGAKSLVSHEWWVPRGAYMNGRAMELTSILGPFFHISALPDNTLFKSQPDVGQQCFSEASERRPADLLSSFSTIKNFMNILYSGLHDVLMILLKSTDTRERVLQFLAEVINANASRAHIQVDPVSCASSGMFVNLSAVMLRLCEPFLDPHLTKRDKIDPKYAFCGHRLKLSDLTALHASSEEVTEWIGKDAMANANDAGRENGNESRLLQSKEATSSSSNASGQNAKSATKYTFICECFFMTARVLNLGLLKALSDFKHLAQDISRGEDNLATLKAMRDQAPSPQLELDISRMEKELELSSQEKLCHEAQILRDGDFIQRALSFYRLMVVWLVGLVGGFKMPLPSTCPMEFSCMPEHFVEDAMELLIFASRIPKALDGVPLDDFMNFIIMFMASPEYVRNPYLRAKMVEVLNCWMPRSSSSSSATSTLFEGHQLSLEYLVRNLLKLYVDIEFTGSHTQFYDKFNIRHNIAELLEYLWQVPSHRNAWRRIAKDEEKGVYLNFLNFLVNDSIYLLDESLNKILEIKQIEADMSNTAEWEQRPTQERQERTRLFHSQENIVRIDMKLANEDVTMLAFTSEEITAPFLLPEMVERVANMLNYFLLQLVGPQRKSLSLKDPEKYEFRPKQLLKQIVRIYVNLARGDTVNIFPGAISSDGRSYNEQLFNAGADVLRRIGEEGRIIQEFMELGTKAKAAASEALDAEAALGEIPDEFLDPIQYTLMRDPVILPSSRITVDRPIIQRHLLSDNHDPFNRAHLTSDMLIPDIELKAKIDEFVKSHQSKKRTSGEDSSNKERIQTTNSDMLID

>At2g23140.1 68415.m02763 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain

MEVLLRSISSFLNLSSSKHIDLDPFEKYYKRVEELLRVLKPIADVVVTSDFVFDEKLGKAFEELTQDVDQSIDLFRSWQAFSSKVYFVLQIESLLPKMRDTIVDTFQFLMSSKNHLPDELSPASLEQCLEKIKHLSYEEISSVIDGALRDQRDGVGPSPEILVKIGENTGLRSNQEILIEAVALERQKEMAEQSENNAEVEFLDQLIVIVNRMHERLLLIKQTQTSSVAILADFFCPLSLEVMTDPVIVSSGQTYEKAFIKRWIDLGLKVCPKTRQTLTHTTLIPNYTVKALIANWCETNDVKLPDPNKSTSLNELSPLLSCTDSIPSTGADVSARKVSNKSHDWDASSSETGKPSFSSRATEREGASPSRPASALGASSPGISGNGYGLDARRGSLNDFEDRSNDSRELRTDAPGRSSVSSTTRGSVENGQTSENHHHRSPSATSTVSNEEFPRADANENSEESAHATPYSSDASGEIRSGPLAATTSAATRRDLSDFSPKFMDRRTRGQFWRRPSERLGSRIVSAPSNETRRDLSEVETQVKKLVEELKSSSLDTQRQATAELRLLAKHNMDNRIVIGNSGAIVLLVELLYSTDSATQENAVTALLNLSINDNNKKAIADAGAIEPLIHVLENGSSEAKENSAATLFSLSVIEENKIKIGQSGAIGPLVDLLGNGTPRGKKDAATALFNLSIHQENKAMIVQSGAVRYLIDLMDPAAGMVDKAVAVLANLATIPEGRNAIGQEGGIPLLVEVVELGSARGKENAAAALLQLSTNSGRFCNMVLQEGAVPPLVALSQSGTPRAREKVQTL

>At5g67340.1 68418.m08492 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain

MMVHMEVSWLRVLLDNISSYLSLSSMDDLSSNPAHKYYTRGEDIGKLIKPVLENLIDSDAAPSELLNNGFEELAQYVDELREQFQSWQPLSTRIFYVLRIESLASKLRESSLEVFQLLKHCEQHLPADLISPSFEECIELVKLVARDEISYTIDQALKDQKKGVGPTSEVLVKIAESTGLRSNQEILVEGVVLTNMKEDAELTDNDTEAEYLDGLISLTTQMHEYLSDIKQAQLRCPVRVPSDFRCSLSLELMTDPVIVASGQTFERVFIQKWIDMGLMVCPKTRQALSHTTLTPNFIVRAFLASWCETNNVYPPDPLELIHSSEPFPLLVESVRASSSENGHSESLDAEELRQVFSRSASAPGIVSEVVCKTKRNNNAAADRSLTRSNTPWKFPEERHWRHPGIIPATVRETGSSSSIETEVKKLIDDLKSSSLDTQREATARIRILARNSTDNRIVIARCEAIPSLVSLLYSTDERIQADAVTCLLNLSINDNNKSLIAESGAIVPLIHVLKTGYLEEAKANSAATLFSLSVIEEYKTEIGEAGAIEPLVDLLGSGSLSGKKDAATALFNLSIHHENKTKVIEAGAVRYLVELMDPAFGMVEKAVVVLANLATVREGKIAIGEEGGIPVLVEVVELGSARGKENATAALLQLCTHSPKFCNNVIREGVIPPLVALTKSGTARGKEKAQNLLKYFKAHRQSNQRRG

>At3g54850.1 68416.m06077 armadillo/beta-catenin repeat family protein / U-box domain-containing family protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain

MGLTNCCSHEELMSRLVDSVKEISGFSSSRGFIGKIQGDLVRRITLLSPFFEELIDVNVELKKDQITGFEAMRIALDSSLELFRSVNGGSKLFQLFDRDSLVEKFRDMTVEIEAALSQIPYEKIEVSEEVREQVQLLHFQFKRAKERWEESDLQLSHDLAMAENVMDPDPIILKRLSQELQLTTIDELKKESHAIHEYFLSYDGDPDDCFERMSSLLKNLVDFVTMESSDPDPSTGSRIVSRHRSPVIPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGLTPNYVLKSLIALWCESNGIELPQNQGSCRTTKIGGSSSSDCDRTFVLSLLEKLANGTTEQQRAAAGELRLLAKRNVDNRVCIAEAGAIPLLVELLSSPDPRTQEHSVTALLNLSINEGNKGAIVDAGAITDIVEVLKNGSMEARENAAATLFSLSVIDENKVAIGAAGAIQALISLLEEGTRRGKKDAATAIFNLCIYQGNKSRAVKGGIVDPLTRLLKDAGGGMVDEALAILAILSTNQEGKTAIAEAESIPVLVEIIRTGSPRNRENAAAILWYLCIGNIERLNVAREVGADVALKELTENGTDRAKRKAASLLELIQQTEGVAVTTVP

>At3g46510.1 68416.m05049 armadillo/beta-catenin repeat family protein / U-box domain-containing family protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain

MEEEKASAAQSLIDVVNEIAAISDYRITVKKLCYNLARRLKLLVPMFEEIRESNEPISEDTLKTLMNLKEAMCSAKDYLKFCSQGSKIYLVMEREQVTSKLMEVSVKLEQSLSQIPYEELDISDEVREQVELVLSQFRRAKGRVDVSDDELYEDLQSLCNKSSDVDAYQPVLERVAKKLHLMEIPDLAQESVALHEMVASSGGDVGENIEEMAMVLKMIKDFVQTEDDNGEEQKVGVNSRSNGQTSTAASQKIPVIPDDFRCPISLEMMRDPVIVSSGQTYERTCIEKWIEGGHSTCPKTQQALTSTTLTPNYVLRSLIAQWCEANDIEPPKPPSSLRPRKVSSFSSPAEANKIEDLMWRLAYGNPEDQRSAAGEIRLLAKRNADNRVAIAEAGAIPLLVGLLSTPDSRIQEHSVTALLNLSICENNKGAIVSAGAIPGIVQVLKKGSMEARENAAATLFSLSVIDENKVTIGALGAIPPLVVLLNEGTQRGKKDAATALFNLCIYQGNKGKAIRAGVIPTLTRLLTEPGSGMVDEALAILAILSSHPEGKAIIGSSDAVPSLVEFIRTGSPRNRENAAAVLVHLCSGDPQHLVEAQKLGLMGPLIDLAGNGTDRGKRKAAQLLERISRLAEQQKETAVSQPEEEAEPTHPESTTEAADT

>At2g28830.1 68415.m03505 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain

MAKSEKHKLAQTLIDSINEIASISDSVTPMKKHCANLSRRLSLLLPMLEEIRDNQESSSEVVNALLSVKQSLLHAKDLLSFVSHVSKIYLVLERDQVMVKFQKVTSLLEQALSIIPYENLEISDELKEQVELVLVQLRRSLGKRGGDVYDDELYKDVLSLYSGRGSVMESDMVRRVAEKLQLMTITDLTQESLALLDMVSSSGGDDPGESFEKMSMVLKKIKDFVQTYNPNLDDAPLRLKSSLPKSRDDDRDMLIPPEEFRCPISLELMTDPVIVSSGQTYERECIKKWLEGGHLTCPKTQETLTSDIMTPNYVLRSLIAQWCESNGIEPPKRPNISQPSSKASSSSSAPDDEHNKIEELLLKLTSQQPEDRRSAAGEIRLLAKQNNHNRVAIAASGAIPLLVNLLTISNDSRTQEHAVTSILNLSICQENKGKIVYSSGAVPGIVHVLQKGSMEARENAAATLFSLSVIDENKVTIGAAGAIPPLVTLLSEGSQRGKKDAATALFNLCIFQGNKGKAVRAGLVPVLMRLLTEPESGMVDESLSILAILSSHPDGKSEVGAADAVPVLVDFIRSGSPRNKENSAAVLVHLCSWNQQHLIEAQKLGIMDLLIEMAENGTDRGKRKAAQLLNRFSRFNDQQKQHSGLGLEDQISLI

>At3g07360.1 68416.m00877 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain

MAKTGVFDSDPTAIAKAKELKREMKKLLIKIDDEDDLGVQTIDQLQDALSALREATMRKMAKSSSLEMLETVSCPEEFRCPLSNELMRDPVVLASGQTYDKLFIQKWLSSGNRTCPKTQQVLPHTALTPNLLIREMISKWCKKNGLETKSQYHPNLVNEDETVTRSDREIFNSLLCKVSSSNLQDQKSAAKELRLLTRKGTEFRALFGESPDEITRLVNPLLHGSNPDEKLQEDVVTTLLNISIHDDSNKKLVCENPNVIPLLIDALRRGTVATRSNAAAAIFTLSALDSNKVLIGKSGILKPLIDLLEEGNPLAIKDVAAAIFTLCIAHENRSRAVRDGAVRVLGKKISNGLYVDELLAILAMLVTHWKAVEELGELGGVSWLLKITRESECKRNKENAIVILHTICFSDRTKWKEIKEEENAHGTITKLSREGTSRAQRKANGILDRLRKAMNLTHTA

>At1g27910.1 68414.m03420 U-box domain-containing protein contains Pfam profile PF04564: U-box domain

MDVNEVEENFFAPGDAKLHGKMCNALSVIYCKIMSIFPSLEAARPRSKSGIQALCSLHVVLEKVKNILRHCTESSKLYLAITGDSVVLKFEKAKSSLTDSLRRVEDIVQQSIGSQLLEILMELENTEFSLDPAEKEIGDQIIGLLQQGGNFESSSDNNELEVFHQAATRLGITSSRAALTERRCLKKLIERARMEDDKRKESIVAYLLHLMRKYSKLFRSEIWDDNDSQGSSSLPCSPTIQGSIDDAHGRAFDRQLSKLSSFNFRSCNNNRRSSQMSVPPEELRCPISLQLMYDPVIIASGQTYERICIEKWFSDGHNTCPKTHQQLSHLCLTPNYCVKALISSWCEQNGVQVPDGPPESLDLNYWRLALSVSESTDTRSAKRVGSCKLKDVKVVPLEESGTIKEEACESEYQEDQVTLVERCTELLTTLTDVDTLRKKCRVVEQIRVLLKDDEEARILMGENGCVEALLQFLGSALNENNASAQKVGAMALFNLAVDNNRNKELMLASGIIPLLEEMLCNPHSHGSVTAIYLNLSCLEEAKPVIGSSLAVPFMVNLLWTETEVQCKVDALHSLFHLSTYPPNIPCLLSADLVNALQSLTISDEQRWTEKSLAVLLNLVLNEAGKDEMVSAPSLVSNLCTILDTGEPNEQEQAVSLLLILCNHSEICSEMVLQEGVIPSLVSISVNGTQRGRERAQKLLTLFRELRQRDQTHLTEPQHTEVTSPEDGFSVASAAVTETKPQCKSASRKKMGRAFSFLWKSKSFSVYQC

>At1g24330.1 68414.m03069 armadillo/beta-catenin repeat family protein / U-box domain-containing family protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain

MDVSELEENLFAASDAKLHGDMCKELSAVYCKVLSIFPSLEEARPRSKSGIQTLCSLHIALEKAKNILQHCSECSKLYLAITGDAVLLKFEKAKSALIDSLRRVEDIVPSSIGSQILDIVGELEHTKFLLDPSEKEVGDRIIALLQQGKKFDNGSDSTELEIFHQAATRLSITSSRSALAERRALKKVIDRARVEEDKRKESIVAYLLHLMRKYSKLFRSEMMDENDSPCSTPCSPTGQGPNEDRVNAFGRQLSKFGSINYKPMNSRKSGQMPIPPEELRCPISLQLMYDPVIIASGQTYERVCIEKWFSDGHNSCPKTQQQLPHLSLTPNYCVKGLIASWCEQNGITVPTGPPESLDLNYWRLAMSDSESPNSKSVDSVGLCTPKDIRVVPLEESSTIESERQQKEKNNAPDEVDSEINVLEGYQDILAIVDKEEDLAKKCKVVENVRILLKDNEEARILMGANGFVEAFLQFLESAVHDNNAAAQETGAMALFNLAVNNNRNKELMLTSGVIPLLEKMISCSQSQGPATALYLNLSCLEKAKPVIGSSQAVSFFVNLLLQDTKTQCKLDALHALYNLSTYSPNIPTLLSSNIIKSLQVLASTGNHLWIEKSLAVLLNLASSREGKEEMITTQGMISTLATVLDTGDTVEQEQAVSCLVILCTGSESCIQMVLQEGVIPSLVSISVNGSPRGRDKSQKLLMLFREQRHRDQPSPNKEEAPRKTVSAPMAIPAPVSAPESEVKPLTKSISRRKTMTRPFSFLWKKSHSIHH

>At1g49780.1 68414.m05582 U-box domain-containing protein similar to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain

MPGNLEPLDLGIQIPYHFRCPISLDLMSDPVTISTGQTYDRTSIDSWIAMGNTTCPVTRVALSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPISVRSLLSQASAITGTHVSVRSRAAAIRRLRGLARDSEKNRVLIAGHNAREILVRILFADIETTSLSSELVSESLALLVLLHMTETECEAVASDPSRVGFMTRLLFDSSIEIRVNAAALIEMVLTGAKSMDLKLIISGSDSIFEGVLDLLKNPISSRRALKIGIKAIFALCLVKQTRHLAISAGAPGILIDRLAADFDRCDTERGLATVELLCRLPEGCAAFGEHALTVPLMVKTILRVSDRATEYAAGALLALCTAEERCRDEAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSTVHSDDFNRSEVAPF

>At5g42340.1 68418.m05155 armadillo/beta-catenin repeat family protein / U-box domain-containing protein low similarity to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200, GI:14582198; contains Pfam profiles PF04564: U-box domain, PF00514: Armadillo/beta-catenin-like repeat

MDTDEEATGDAENRDEEVTAEEPIHDEVVDAVEIHEEEVKEDDDDCEGLVSDIVSIVEFLDQINGYRRTQQKECFNLVRRLKILIPFLDEIRGFESPSCKHFLNRLRKVFLAAKKLLETCSNGSKIYMALDGETMMTRFHSIYEKLNRVLVKAPFDELMISGDAKDEIDSLCKQLKKAKRRTDTQDIELAVDMMVVFSKTDPRNADSAIIERLAKKLELQTIDDLKTETIAIQSLIQDKGGLNIETKQHIIELLNKFKKLQGLEATDILYQPVINKAITKSTSLILPHEFLCPITLEIMLDPVIIATGQTYEKESIQKWFDAGHKTCPKTRQELDHLSLAPNFALKNLIMQWCEKNNFKIPEKEVSPDSQNEQKDEVSLLVEALSSSQLEEQRRSVKQMRLLARENPENRVLIANAGAIPLLVQLLSYPDSGIQENAVTTLLNLSIDEVNKKLISNEGAIPNIIEILENGNREARENSAAALFSLSMLDENKVTIGLSNGIPPLVDLLQHGTLRGKKDALTALFNLSLNSANKGRAIDAGIVQPLLNLLKDKNLGMIDEALSILLLLASHPEGRQAIGQLSFIETLVEFIRQGTPKNKECATSVLLELGSNNSSFILAALQFGVYEYLVEITTSGTNRAQRKANALIQLISKSEQI

>At1g67530.1 68414.m07694 armadillo/beta-catenin repeat family protein / U-box domain-containing family protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain

MDVTELEENLFAASDAKLHGDMCKELSGVLCKVLSIFPSLEGARPRSKSGIQALCSLHIALEKAKNILQHCSECSKLYLAITGDAVLLKFEKAKIALIDGLKRVEDIVPSSIGSQILEIVGELENTRFMLDPSEKEVGDQIIALLQQGKKFDNCNDNTELEIFHRAATRLSITSSRVALAERRALKKLIDRARAEEDKRKESIVAYLLHLMRKCSKLFRSEILDENDSPGSYPCSPNEDHGSVHGFGRQLSRFGSLNDKPMNSINSGQMPVPPEELRCPISLQLMCDPVIIASGQTYERVCIEKWFSDGHNTCPKTQQQLPHISLTPNNCVKGLIASWCEQNGTQIPSGPPESQDLDYWRLALSDSESTKSQSVNSIGSYKLKGVKIVPLEENGTTVVERQNTEESFVSDDDDEEDSDINVLERYQDLLAVLNEEEGLEKKCKVVEKIRLLLKDDEEARIFMGANGFVEALLRFLGSAVDDNNAAAQDSGAMALFNLAVNNNRNKELMLTSGVIRLLEKMISSAESHGSATALYLNLSCLDEAKSVIGSSQAVPFLVQLLQKEIETQCKLDALHALYNLSTYSPNIPALLSSNIIKSLQGLLASTGENLWIEKSLAVLLNLASSQEGKDEAVSSQGMISSLATVLDMGDTTEQEQAVSCLLILCNGRESCIQMVLQEGVIPSLVSISVNGTPRGREKSQKLLMLFREERQQRDQPSSNRDEPPQKEPARKSLSAPLSVHGSTPASASVQDYEPRVLSKSMSRRKSMARPFSFFWKKSYSVRE

>At1g66160.1 68414.m07509 U-box domain-containing protein similar to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain

MGLSLRVRRRGGSVSKKEIIPVTSCSEEVEITIPSQFQCPISYELMKDPVIIASGITYDRENIEKWFESGYQTCPVTNTVLTSLEQIPNHTIRRMIQGWCGSSLGGGIERIPTPRVPVTSHQVSEICERLSAATRRGDYAACMEMVTKMTRLGKESERNRKCVKENGAGLVLCVCFDAFSENANASLLLEETVSVLTWMLPIGLEGQSKLTTTSSFNRLVELLRNGDQNAAFLIKELLELNVTHVHALTKINGVQEAFMKSINRDSTCVNSLISIHHMILTNQETVSRFLELDLVNITVEMLVDSENSVCEKALTVLNVICETKEGREKVRRNKLVIPILVKKILKISEKKDLVSVMWKVCKSGDGSEVEEALRLGAFKKLVVMLQVGCGEGTKEKVTELLKMMNKVMKMNGFVDRSYSSSIEFKHVKKPF

>At5g01830.1 68418.m00102 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain

MAVTLDSPSPARKRRPLVVGSFESPKLSSDTKLTRSLFLASHEISSMQPLPFILRRNSLSLIRKVKILASVFDELLLPRSQLVVYSQSAHLCFEEMQIVMQRIKSLIDDCSRVSKLWLLLQIDIVAFNFHELVTDLSTVLDILPLHDFDLSDDAQDLISLLTKQCSDSVQFVDARDVALRRKVTDTIAGIKHQISPDHSTLIKIFNDLGLSDSASLTDEIQRLEDEIQDQIDDRSKSAAASLIGLVRYSKCVLYGPSTPAPDFRRHQSLSDANIPADFRCPITLELMRDPVVVATGQTYDRESIDLWIQSGHNTCPKTGQVLKHTSLVPNRALKNLIVLWCRDQKIPFELYGDGGGEPAPCKEAVEFTKMMVSFLIEKLSVADSNGVVFELRALAKSDTVARACIAEAGAIPKLVRYLATECPSLQINAVTTILNLSILEQNKTRIMETDGALNGVIEVLRSGATWEAKANAAATLFSLAGVSAYRRRLGRKARVVSGLVDLAKQGPTSSKRDALVAILNLVAERENVGRFVEAGVMGAAGDAFQELPEEAVAVVEAVVRRGGLMAVSAAFSLIRLLGEVMREGADTTRESAAATLVTMCRKGGSELVAEMAAIPGIERVIWEMIGAGTARGGRKAASLMRYLRRWAAGDTHNTAAETQSIVVPTPSRIFSPVL

>At3g19380.1 68416.m02458 U-box domain-containing protein contains similarity to immediate-early fungal elicitor protein CMPG1 GI:14582200 [Petroselinum crispum]; contains Pfam profile PF04564: U-box domain

MPRNIEPLDLGIQIPYHFRCPISLELMQDPVTVCTGQTYDRASIESWVSIGNNTTCPVTRAPLSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPTSVRALLSQASAITGTHVSVRSRAAALRRLRGFARDSDKNRVLIAAHNATEILIKILFSETTSSELVSESLALLVMLPITEPNQFVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVSTGTKSADLKGSISNSESVFEGVLDLLRNPISSRRALKIGIKTLFALCSVKSTRHIAITAGAPEILIDRLAADFDRCDTERALATVELLCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERWREEAAGAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWPDYNSFANSDDFGCSSQVVPF

>At5g37490.1 68418.m04515 U-box domain-containing protein similar to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain

MGFLWRTRSNEKKITPVLSWPESEPESEITIPPEFQCPISIDLMKDPVIISTGITYDRVSIETWINSGNKTCPVTNTVLTTFDQIPNHTIRKMIQGWCVEKGSPLIQRIPTPRVPLMPCEVYEISRKLSSATRRGDYEKCGVIIEKIKKLGDESEKNRKCVNENSVGWVLCDCFDKFSGDEKLTFMLNEILSLLTWMFPIGLEGISKLASATSFRCVAGLLKSTDDSVRQNAAFIMKEILSLDETRVHSFAVENGVAEALVKLIRDSVSSSSTKSSLIAIYQMVLQKPEIASEFLEIGLVSITVEMIVDAENSVCEKALAVLDAICETEHGREEVRKNALVMPLLVKKIAKVSELATRSSMSMILKLWKTGNTVAVEDAVRLGAFQKVLLVLQVGYGEETKEKATELLKMMNTQMKLMSDCVDSLKEFKYIKKPF

>At2g35930.1 68415.m04410 U-box domain-containing protein similar to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain

MSGGIMDEEIEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFAGKKNSCPVTKQDITDADLTPNHTLRRLIQSWCTLNASYGVERIPTPRPPICKSEIEKLIRDSASSHENQVKCLKRLRQIVSENATNKRCLEAAGVPEFLANIVSNDSENGSLTDEALNLLYHLETSETVLKNLLNNKKDNNIVKSLTKIMQRGMYESRVYATLLLKNILEVADPMQSMTLKPEVFTEVVQILDDRISQKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFTSERRGPEMAMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFCATPALLHEMLQLGVVAKLCLVLQVSCGGKTKEKAKELLKLHARVWKDSPCLPKNMILAYPC

>At3g52450.1 68416.m05768 U-box domain-containing protein similar to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain

MDQEIEIPSFFLCPISLDIMKDPVIVSTGITYDRESIEKWLFSGKKNSCPVTKQVITETDLTPNHTLRRLIQSWCTLNASYGIERIPTPKPPICKSEIEKLIKESSSSHLNQVKCLKRLRQIVSENTTNKRCLEAAEVPEFLANIVSNSVDTYNSPSSSLSSSNLNDMCQSNMLENRFDSSRSLMDEALSVLYHLDTSETALKSLLNNKKGTNLVKTLTKIMQRGIYESRAYAALLLKKLLEVADPMQIILLERELFGEVIQILHDQISHKATRSAMQILVITCPWGRNRHKAVEGGTISMIIELLMDDTFSSERRNSEMAMVVLDMLCQCAEGRAEFLNHGAAIAVVSKKILRVSQITSERAVRVLLSVGRFCATPSLLQEMLQLGVVAKLCLVLQVSCGNKTKEKAKELLKLHARVWRESPCVPRNLYDSYPA

>At3g61390.2 68416.m06872 U-box domain-containing protein several hypothetical proteins - Arabidopsis thaliana

MTLKIPIQEMVKMVGSLRSHGIDIPESMEINKKEKIYVAVTEKDLESKSSLVWAIQNSGGKEFCIVHVHQPIPGEMFHEQKLRLYRKEKDKAHKNSEKYLQICRQMQVTAEIIYIETDSVEKGILQLISQRGVTKLVMGAAADRHYSMRMRDLKSKKAIYIHREAPATCLIWFTCNGYLICSREARRANNLYLECASSNSLSQSDITRGTESIVKDDDHLIKLAVTEAEASKRKARFEACKREEAEKTAVDALKKAKQWENVYFEELKQRKETEKALRKRNDELEKMRSESETQITESYTVIRKLQEKNNLSMETFRGIREEQEELKIKLREVSKLKGKREEEEASTSNHREPPQYFICPITHDIMEDPHVAADGFTYEGEAISRWFERGHETSPMINKRLPHTSLVPNLALRSAIQEWLQLRELLNRPSACREI

>At1g23030.1 68414.m02877 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain

MAGGIVSPASLLDLIADIVEIPLNTGMFKKDCADLTRRVCLLTHLLEEIRDSTPIDSAASSSSENDWWSDLVVGLQAAKRLLSTARFQARDSSDGAAKRISFQFQCVTWKLEKALSNLPYDLYDISDEVGEQVELARSQLRRAMQRYGSLNSNKFSSALSEPMERDGFSNVIKIKAEEKLESVSETLHFGEEEEKQSSPPLRRSSSISLAYYLSKDADTDRLDKMVNKNTDESKKSDKLTIPVDFLCPVSLELMKDPVIVATGQTYERAYIQRWIDCGNLTCPKTQQKLENFTLTPNYVLRSLISRWCAEHNIEQPAGYINGRTKNSGDMSVIRALVQRLSSRSTEDRRNAVSEIRSLSKRSTDNRILIAEAGAIPVLVNLLTSEDVATQENAITCVLNLSIYENNKELIMFAGAVTSIVQVLRAGTMEARENAAATLFSLSLADENKIIIGGSGAIPALVDLLENGTPRGKKDAATALFNLCIYHGNKGRAVRAGIVTALVKMLSDSTRHRMVDEALTILSVLANNQDAKSAIVKANTLPALIGILQTDQTRNRENAAAILLSLCKRDTEKLITIGRLGAVVPLMDLSKNGTERGKRKAISLLELLRKACQ

>At1g29340.1 68414.m03587 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain

MASAAIFSSLRRRRSPSLEAFLAPVDLSGVALVQTLASISSEVVSCFTSVRFSFQRKNARSLIRKIEIFVVLFEFLVDSNWGSTTTRTRARRRSKSSVSESTALLCLKELYLLLYRSKILVDYCAQSSKLWLLLQNPSISGYFHDLNQEISTLLDVLPVNDLGLSDDIREQIELLQRQSRKARLYIDKNDESLRESFYSFLDGFENGKIPSSVDLRMFFVEKLGIRDSKSCRSEIEFLEEQIVNHDGDLEPTGSVINGFVAITRYCRFLLFGFEEDGMEWWIENNPKKPRKGFVAQEIGDTFITVPKDFVCPISLDLMTDPVIISTGQTYDRNSIARWIEEGHCTCPKTGQMLMDSRIVPNRALKNLIVQWCTASGISYESEFTDSPNESFASALPTKAAVEANKATVSILIKYLADGSQAAQTVAAREIRLLAKTGKENRAYIAEAGAIPHLCRLLTSENAIAQENSVTAMLNLSIYEKNKSRIMEEGDCLESIVSVLVSGLTVEAQENAAATLFSLSAVHEYKKRIAIVDQCVEALALLLQNGTPRGKKDAVTALYNLSTHPDNCSRMIEGGGVSSLVGALKNEGVAEEAAGALALLVRQSLGAEAIGKEDSAVAGLMGMMRCGTPRGKENAVAALLELCRSGGAAVAEKVLRAPAIAGLLQTLLFTGTKRARRKAASLARVFQRRENAAMRSGVYGFVGNTNGNRDGGFTTDVSVPISISISVPVL

>At5g64660.1 68418.m08126 U-box domain-containing protein similar to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain

MRKDDLCITVPTFFRCPISLDVMKSPVSLCTGVTYDRASIQRWLDGGNNTCPATMQILQNKDFIPNRTLQRLIEIWSDSVRRRTCVESAELAAPTRDEIADAIDRVKIEKEERDDREVLSKIVRFGRESDDNRGFLAGKDDFVKLLVDLINQVDFETTSAAKSLVVQEAVKILSTIRSKVSDRRRFSNLILTNGRDRLSVIVYLFKTGNVELKIDCAGLLEFIAVDAESKLLIAERDGLITELMKSISKDSDLSLIESSLSCLIAISSPKRVKLNLLREKLIGDVTKLLSDSTSSLSVSVTEKCLKLLEILASTKEGRSEICGGDGECLKTVVKKLMKVSTAATEHAVTVLWSVSYLFKEDKALEAVTSVNGVTKILLLLQSNCSPAVRRMLTDLLKVFKVNSRSCLSAYDTKTTHIMPF

>At5g09800.1 68418.m01134 U-box domain-containing protein low similarity to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain

MRSDDLYITTVPCFFKCPISLDVMKSPVSLSTGVTYDRVSIQRWLDDGNNTCPATMQILQNKEFVPNLTLHRLIDHWSDSINRRADSESPESDTPTRDEINAAIERFRIENDARSKILRFARESDENREFLAGKDDFVAMLVDLISDSRNFSDSQLLLVGEAVKILSMIRRKIFDRRRLSNLILTNGGDCLTSFFLLIKRGNPKLKIDCSAVLEFIAVDAESKLIIAKGEGLVTEIIKLISSDSDSSLIEANLSLLIAIASSKRVKLALIREKLVTKLTSLLTDPTTSVSVTEKCLKLLEAISSCKEGRSEICDGVCVETVVNKLMKVSTAATEHAVTVLWSVCYLFKEKKAQDAVIRINGVTKILLLLQSNCSLTVRHMLTDLLKVFKVNSRSCLSVYETKTTHIMPF

>At1g71020.1 68414.m08197 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain

MAGGAITPDSLIGLIAEINEIPGNFGLFKKDCSDLARRVGLLTHLIEEIRDSSPPSESDASSSLNSHECDWWSDLVVGLQAAKRLLSSATSFQARESSDGAAKRISFQFQCVTWKLEKALGDLTYDRYDISDEVREQVELARLQLRRAMQRYGSLNSKKFSSGLSEPMEKDASSNRKVIEKLESIPETVHSLSDEKKFESPPPWKSSSVSLAFFLSKDGDDERLEKAVTENSDDSQKSDNLTIPEDFLCPISLELMKDPAIVSTGQTYERSFIQRWIDCGNLSCPKTQQKLENFTLTPNYVLRSLISQWCTKHNIEQPGGYMNGRTKNSDGSFRDLSGDMSAIRALVCKLSSQSIEDRRTAVSEIRSLSKRSTDNRILIAEAGAIPVLVKLLTSDGDTETQENAVTCILNLSIYEHNKELIMLAGAVTSIVLVLRAGSMEARENAAATLFSLSLADENKIIIGASGAIMALVDLLQYGSVRGKKDAATALFNLCIYQGNKGRAVRAGIVKPLVKMLTDSSSERMADEALTILSVLASNQVAKTAILRANAIPPLIDCLQKDQPRNRENAAAILLCLCKRDTEKLISIGRLGAVVPLMELSRDGTERAKRKANSLLELLRKSSRKLGSL

>At5g65500.1 68418.m08240 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain

MEETKTHELEVEAESGSRMEKVYIAVGNDVQEGYKTIHWALKKWNNIPISIVLLHLCNISQDFVYTPFGKLPASSVSEEKLQVLRKYEDQKIDKLLSKYITFCGKVCPLSVNFVLFGKSKSAISGSFYVYQNKPEFCEFYIICGGKMVSLKNDVNNNNSNIRSWIGKMFHDPGRNLDRSSGNNDDPTASGSSWDKNLQEIENYFQQLLSLNLAEEETENVVEEEQEDDDDVALNVLQHMDVAEKLEYVRRKVNEAKLMIDEKSREVKVNAERSNRAEWAISLCNSRIGEFEAWIKEESERREKLQATLDSDKECIEEAKNYVEKGKTKLHSLAELQEVLSSKVKTMMEAKSQAEVELERVVLQRGEMITEIEKLRSQRDVFNRRIEFCKEREVIGSVSKEEVKCGYREYVAEDIRLATETYSDRLRLKSGGNWTNVYRGRIKHTTVAVKVIGDSLSDEAFGAKVKLLNEIRHPNLVAIAGFCSQRPKCLLFEYMHNGNLRDNLFTSQRKSRRSKILKWHDRIRIAHQVCSGLGFLHSVKPKPIVHGRLTPSKILLDRNLVPKITGFGLIMHSDQSDTKPDVMAFGVLLLHLLTGRNWHGLLKAMSMNQTSILRDLDQTAGKWPLELAKEFGALAVKCSSVNRGGNMDFSTKEIMEELGKIREKADEFKTKGGYEEATNSNMDEGDPNDIPSVFMCPILQEVMKNPHVAADGFSYELEAIQEWLSMGHDTSPMTNLRLDYQMLTPNHTLRSLIQDWHSKRAAQASS

>At2g45920.1 68415.m05710 U-box domain-containing protein contains Pfam profile PF04564: U-box domain

MMGKSGSQQLLMDEKIYVAVGSDLGNKSTLVWAIQNTGGKEFCIVHVHQPLYRKEKEKTQKILDKYLQKCRQMQVCAEMIHIKMESVEKGIIQLISERNVKKLVMGAASDTRYSMRMADLLSTKAIYIRQEAPATCCIWFTCKGYLVYKRESIMGNTSLEYASTSSGQDSVRSRGSVIPSRQFTISRGNGNVYQLAVFEAEKSKKEASLEAFKHQEVVKEKNEAIKRGKEWESAYLEELKQRKETEMELKKVREKLEKMRYISENRITESYMLVQKLQDKYNLATKVLRKAKEERDLLIKGRDIAIIEVEELRKEVSRSDEHREAPQYFICPISLEVMKDPQLAADGFTYEAEAISTWLQGGHETSPMTNTKLHHTKLVPNLALRSAIQEWLHASSSFRK

>At1g01660.1 68414.m00084 U-box domain-containing protein

MAELMAMGNDVVHVAVKSDVRESRSTLLWALRNLGAKKVCILHVYQPKTASPAARKLEELEAIMYETLHDYFDFCQQEGVNEDDIYISCIEMNDVKQGILELIHESKIKKLVMGAASDHHYSEKMFDLKSRKAKYVYQHAPSSCEVMFMCDGHLIYTKEANLEDCMGETESEAGQSKPKLYSSASPKCSAELVSAIVAYIDTRRDRDMLEPNASEDQSESDRNDQLYRQLKQALMEVEESKREAYEECVRRFKAENTAVEAIRSAREYEAMYNEEAKLRKEGKEALAKQRKMVEKTKQERDDALIIILNGRKLYNEELRRRVEAEEMLGKEKEEHERTKKEIEEVRAIVQDGTLYNEQLRHRKEMEESMKRQEEELEKTKKEKEEACMISKNLMQLYEDEVRQRKEAEELVKRRREELEKVKKEKEEACSVGQNFMRLYEEEARRRKGTEEELSKVAAEKDAASSVCSEILLLLQSYTRRHGTPSGFSDEDSVTRQPPSYFICPISQEVMREPRVAADGFTYEAESLREWLDNGHETSPMTNLKLAHNNLVPNHALRSAIQEWLQRNS

>At2g45910.1 68415.m05709 protein kinase family protein / U-box domain-containing protein contains Pfam profiles PF00069 Eukaryotic protein kinase domain, PF04564: U-box domain; supported by tandem duplication of (GI:3386604) (TIGR_Ath1:At2g45920) [Arabidopsis thaliana]

MALVSPIPAMGERAGSMRFHGIGSPGSRSSRSGIMDEPVSRLIDEKIFVAVDKHVAKSKSTLIWALQNTGGKKICLIHVHQPSQMIPLMGAKFPVGAVKEEEVRVFREKEREKVHMILDDYLRICQQRGVRAEKMFIEMESIENGIVQLISELGIRKLVMGAAADRHYSRRMTDLKSRKAIFVRREAPTLCQIWFTCKGYLIHTREATMDDTESEYASPRPSISASDLLQTFSTPESEHQHISRVQSTDSVQQLVSNGSSTEQSGRVSDGSLNTDEEERESDGSEVTGSATVMSSGHSSPSSFPDGVDDSFNVKIRKATSEAHSSKQEAFAETLRRQKAEKNALDAIRRAKQSESAYSEELKRRKDTEIAVAKEKERFITIKNEQEVIMEELQSAMAQKAMLESQIAKSDGTMEKLNQKLDIAVKLLQKLRDEREELQTERDRALREAEELRSHAETSTLQLPQYFTDFSFSEIEEATNHFDSTLKIGEGGYGSIYVGLLRHTQVAIKMLNPNSSQGPVEYQQEVDVLSKMRHPNIITLIGACPEGWSLVYEYLPGGSLEDRLTCKDNSPPLSWQNRVRIATEICAALVFLHSNKAHSLVHGDLKPANILLDSNLVSKLSDFGTCSLLHPNGSKSVRTDVTGTVAYLDPEASSSGELTPKSDVYSFGIILLRLLTGRPALRISNEVKYALDNGTLNDLLDPLAGDWPFVQAEQLARLALRCCETVSENRPDLGTEVWRVLEPMRASSGGSSSFHLGRNEHRIAPPYFICPIFQEVMQDPHVAADGFTYEAEAIRAWLDSEHDTSPMTNVKLSHTSLIANHALRSAIQEWLQHHL

>At5g61550.1 68418.m07724 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain; protein kinase 1, PnPK1, Populus nigra, EMBL:AB041503

MEEKKVVRALSEHLSLPPPPSPSVAVAINGKKKSKYVVFWALEKFIPEGFTDFKLLYVRPPVSYIPTPMGIAVAVSELREDVVSAYKQELDWSANEMLRPYKKMFERRKVQVEVLLLDSLEPAAAIAEEIAGTGVTKLVIGMSLRGFFSRKIDMSSLIATAVPRFCTVYVISKGKLASVRPSESDASGSIRFERSSSTSGSTDSPRLPPEYQDFLSAVSEAQSRVSPFSPALKHSMGSNAVAQMDTSSSGTDQEEVSTGRGMEIVHSGIEGKKNKDESFSASFPMGTEAYNSMSWTSKWRDHEDRREMRSSSSSNNHDLVNMDWGAVVPENYSWVSHTASHMSDGLLSVHSITDNQVNLNFEIEKLRAELKHVQEMYAMAQTETVGASKKLTELNQRRFEESEKLVELKEKEEVAKDTASKEKQRYEEAMKEAEKVKELMMKEALHRREAEFKAERDAREKDKLQASLVSPGVQYQHYTWEEIAAATSDFAENLKIGIGAYGSVYKCNLHHTTGAVKVLHAGETQLSKQFDQELEILSKIRHPHLVLLLGACPERGCLVYEYMDNGSLDDRLMLVNDTPPIPWFERFRIALEVASALVFLHKSKPRPIIHRDLKPGNILLDHNFVSKLGDVGLSTMVNQDDVSSRTIFKQTSPVGTLCYIDPEYQRTGIISPKSDVYSLGVVILQLITAKPAIAITHMVEEAIGDDAEFMAILDKKAGSWPISDTRELAALGLCCTEMRRRDRPDLKDQIIPALERLRKVADKAQNLLSRTPSGPPSHFICPLLKGVMNEPCVAADGYTYDREAIEEWLRQKDTSPVTNLPLPNKNLIANYTLYSAIMEWKSNKR

>At3g18710.1 68416.m02376 U-box domain-containing protein similar to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain

MGRDETETYITVPSFFKCPISLDVMRSPVSLCTGVTYDRASIQRWLDGGNNTCPATMQLLKTKDFVPNLTLQRLINIWSDSIGRRHNGDSPVLNPPSGREVPTKEEVNVLLERLMSLENLMKIVRFVKDSDSNREFLSKKMEFVPMLVDIIRTKKTKIELVIMAIRILDSIKVDRERLSNLMLANDGGDCLTAILLAIQRGNLESKIESVRVLDWISFDAKSKLMIAERDGVLTEMMKSISITESSDPSLIEASLSFLITISKSKRVRSKLIAAKAITKIKDILLTETLTNVAVTEKSLKLLETLSSKREGRLEICGDDNGRCVEGVVKKLLKVSTTATEHAVTILWCLCYVFREDKTVEETVERSNGVTKLLVVIQSNCSAMVRQMAKDLIKVLKFNSSALAAYETKTTHIMPF

>At1g01680.1 68414.m00086 U-box domain-containing protein

MEDAIYVAVNQDVRESKKTLLWALKNLQVKKIFLLHVHLPFSLTTSSSRLEQSEIDAIQDSELNTSVNSLYKYRDICINKGVNEKDVDTSMISGHDVGEGIVELIYQNIITNLVMGAAADPHYSRGMSITSRKAEYVSQHAPHSCKIWFICKGKLIKQRERSFYLGNPSDSFSEFSTSAEKPISKGRRRDEEEEPESPKEHPGWILEPEESPKKGRKETIEKSKSNESDEDPRLEDFKCPISMEIMRDPHVAADGFTYEAEEFRKWLRSGGRTSPKTNKPLENHNLVPNHTLRIIIKDWLEKNPNYKR

>At3g49060.1 68416.m05360 protein kinase family protein / U-box domain-containing protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain

MGEIGGEELVLDVDETIFVAVAEDVERSKTTVLWAARNFSGKKICLLYVHRTARAASWTHKKLVGGSFKKHDVKVIERVEKPKVDELMNSYLQLLSETEIQTDKLCIAGQNIEECIVELIARHKIKWLVMGAASDKHYSWKMTDLKSKKAIFVCKKAPDSCHIWFLCKGYLIFTRASNDDSNNRQTMPPLVQLDSDNETRKSEKLESSYMRRRLRYWRSLLEQDGEKDTGQLEREKVEPRAPPLFSSGSSSSFGEPVGPEPVSPELVDSDTLNTSNVEEKEREGDVARKVHRYDKAMHDIGQSDRTVYGEAGKKWEEDASTTEALCKAKALEGLCIKESSQRKRLEELLEKEKLEVKMVIEQNNGFMKELQMVQGRNLKLESQMRKLQDLEKEHGEKFDTAMELLKSFRQKRDEIRIDHENAVKEVNALRRLVKGETGESSGSEMLDYSFMEINEATNEFDPSWKLGEGKYGSVYKGNLQHLQVAVKMLPSYGSLNHFEFERRVEILSRVRHPNLVTLMGACPESRSLIYQYIPNGSLEDCFSSENNVPALSWESRIRIASEICSALLFLHSNIPCIIHGNLKPSKILLDSNLVTKINDYGISQLIPIDGLDKSDPHVDPHYFVSREMTLESDIYAFGIILLQLLTRRPVSGILRDVKCALENDNISAVLDNSAGDWPVARGKKLANVAIRCCKKNPMNRPDLAVVLRFIDRMKAPEVPSSETSSYANQNVPRRPPSHYLCPIFQEVMKDPLIAADGFTYEAEAIREWLANGHDTSPMTNLKMEDCNLIPNHALHLAIQDWQNQW

>At1g01670.1 68414.m00085 U-box domain-containing protein

MTPSSSGLEQSEIDAIQELEQTSRNDTLLKYHDICIDEGVIEQDVDMSCFSANSVGEWIVELIYQNNIKKLIMGATADSHYSEGMVHITPTKADYVIQHAPHCCNIWLVCNGNLIQTREGRFEHAGSAYSSSSSLHSIDSALIPYGGAGRAERVTEPHALSSSEEQSARGIEKMYYEEQRRRLEIEELKREKEQRDKMRRVREEALSSSSGVTKILYNEEVMRRREVEAELNRAKAEIEDMKRVQIELKEQHYADCRLLEKERDEAIKTTEELLRALEKGESSIPLQWSVSIEPPQCFICPISKDIMQNPHVAADGYTYEADEFRRWLNHGGEKSPMTNLRLENRNLIPNLVLRSAIKDWLQQHP

>At5g61560.1 68418.m07725 protein kinase family protein contains protein kinase domain, Pfam:PF00069

MGDGALIVAVAIKGNNSKTKGVVRWALQEFASQEHVVFKLLHVQPRDSNSVSTTRKDLTTSVYKKDVDRKTREMLLPSRDMFVHREVQLDIMVLESDDIADAISKAVQDHGISELVIGASSSIIFSWKLKRSNLSSRIADATPRFCSVHVISKGKLLNVRKSDMDTETSIADDRSESRFSSDSHSGTVSSTSSHQFSSTPLLFQRIQALTTVNQKVGTNIGKQNNEPHHHHHNRAGSLDVDESKLLNQKGFYRTSSSGIGYGGSDISSWRSSQMEEASSSSTYSDPTSSSSQIHKDFELEKLKIELRHIKGMYAVAQSEVIDASKKMQDLNQRRSEEATRLKNLTIREEEADEVVEMERERQEDAENEAELVRECIERETEERLEAEARAEEVRKEKQRLEDALEGGPLQRQQYMKFEWEEIVEATSSFSDELKIGVGGYGSVYRCNLHHTTVAVKVLHSDKSSLTKQFHQELEILSKIRHPHLLLLLGACPERGSLVYEYMHNGSLEERLMKRRPNVDTPQPPPLRWFERFRIAWEIASALYFLHTNEPRPIVHRDLKPANILLDRNNVSKIGDVGLSKMVNLDPSHASTVFNETGPVGTFFYIDPEYQRTGVVTPESDIYAFGIILLQLVTARSAMGLAHSIEKALRDQTGKFTEILDKTAGDWPVKEAKEMVMIGLRCAEMRKRDRPDLGKEILPVLERLKEVASIARNMFADNLIDHHHNAPTHFYCPITKDVMENPCVASDGYTYEKRAIKEWLQKNHKSPMTDLPFPSDSLLPNHSLLSAIKEWRSQLIK

>At5g57035.1 68418.m07119 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain

MTNKFFELIGGAPSYSSVSVAVKGSVGDAVGGTASRRALRWTIENFLPKIDRLVLVHVMPTVTTIPSPSGSKIPIEELDESVVSMYKRDLRKEFEQVFVPFKRICKSNKVETLLLEHHDPAKALLKYMSDTDVECLVIGSCSSNFLTRKKGQEMPLTVLGEAPETCEIYVVCKDRILTKSTNQFTADSSSSFRIPEGAEAYTESFSRTRSDKTGLSASSITSSGRMRIGRPGSLPHSHPTSRVYSDAQSSSTDIVLVDDEHCRSILRHSTVSTSKIQMDPRPHLKTPKSGVRAEVEQLRKEVQTTLSMYKQACEELVHKQTQVQSLSSECIKETERVITALEKEEMRRKAAAEEKEKHLKAVKEVEEAKSMLAKEFCERQLAELDALKQSIEKQKVIEQLFLRDGRYRKYTKEEIAAATDNFSSRKIIGEGGYGKVYKCSLDHTPVALKVLKPDSVEKKEEFLKEISVLSQLRHPHVVLLLGACPENGCLVYEYMENGSLDCHISPKKGKPSLSWFIRFRIIYETACGLAFLHNSKPEPIVHRDLKPGNILLDRNFVSKIGDVGLAKLMSDEAPDSVTVYRNSIIAGTLYYMDPEYQRTGTIRPKSDLYAFGIIILQLLTARHPNGLLFCVEDAVKRGCFEDMLDGSVKDWPIAEAKELARIAIRCSQLKCRDRPDLSTQVLPALKRILESANSRLKTEQANARAPTHYYCPILKEIMEDPQIAADGFTYERKAIKEWIQKHQDVSPVTKHRLKHSDLTPNHTLRSAIREWRSRSRLDLSTTLGSY

>At4g21350.1 68417.m03084 U-box domain-containing protein similar to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582198; contains Pfam profile PF04564: U-box domain

MAFDLPNDFRCPISLEIMSDPVILQSGHTFDRVSIQQWIDSGNRTCPITKLPLSETPYLIPNHALRSLILNFAHVSLKESSRPRTQQEHSHSQSQALISTLVSQSSSNASKLESLTRLVRLTKRDSSIRRKVTESGAVRAALDCVDSCNQVLQEKSLSLLLNLSLEDDNKVGLVADGVIRRIVTVLRVGSPDCKAIAATLLTSLAVVEVNKATIGSYPDAISALVSLLRVGNDRERKESATALYALCSFPDNRKRVVDCGSVPILVEAADSGLERAVEVLGLLVKCRGGREEMSKVSGFVEVLVNVLRNGNLKGIQYSLFILNCLCCCSGEIVDEVKREGVVEICFGFEDNESEKIRRNATILVHTLLGIPMSS

>At5g51270.1 68418.m06356 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain

MDSFFKNSYLDPKAVRAQLPKRADLAAPSEPMTVALAISGSIKSKNVIKWALNKFGSDKNVTFKLIHIHPKITTLPTASGNIVSISEELEEVAAAYRQKVMQETKETLLKPFKKMCERKKLKIDETRFESSLTKVAVELQVLESNSVAVAITKEVNQHLISNLIIGRSSQAASSRNYDITASISASVSNLCTVYVVSNGGVHILAKDTSDTERNDTSIESGFERTSSSCSSGSGANSDVMSNALKSNPHTLSNKRMQNLPTIVRGVSVPMETSSTESDETKKRSSDAAEEASKRSSPETSRSVSWNPQFRDFDERKDAMSSMSSNFEYGNVVTPLGHYFTDNQDTLNEISKLRAELRHAHEMYAVAQVETLDASRKLNELKFEELTLLEHETKGIAKKETEKFEQKRREEREAAQRREAEMKATHEAKEKEKLEESSLVAPKLQYQEFTWEEIINATSSFSEDLKIGMGAYGDVYKCNLHHTIAAVKVLHSAESSLSKQFDQELEILSKIRHPHLVLLLGACPDHGALVYEYMENGSLEDRLFQVNDSQPIPWFVRLRIAWEVASALVFLHKSKPTPIIHRDLKPANILLNHNFVSKVGDVGLSTMIQAADPLSTKFTMYKQTSPVGTLCYIDPEYQRTGRISPKSDVYAFGMIILQLLTGQQAMALTYTVETAMENNNDDELIQILDEKAGNWPIEETRQLAALALQCTELRSKDRPDLEDQILPVLESLKKVADKARNSLSAAPSQPPSHFFCPLLKDVMKEPCIAADGYTYDRRAIEEWMENHRTSPVTNSPLQNVNLLPNHTLYAAIVEWRNRNQ

>At4g25160.1 68417.m03622 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain

MSRSPDKLALPPPPPPPPSRTVVVALSGSSKSKYVVTWAIEKFATEGNVGFKLLHIHPMITSVPTPMGNAIPISEVRDDVVTAYRQEILWQSEEMLKPYTKLFVRRKVAVEVLVIESDNVAAAIAEEVTRDSIDRIVIGGSSRSFFSRKADICSVISALMPNFCTVYVVSKGKLSCVRPSDSDGNATIREDGSERTNSSSGSSGPTSDSSDVMSSAHDSQSRPLSLPVRRMQHFPAIAGQASVPMETSSVGSDETRCMSLDAEEARDVSSINRSSTDTTSRWTPRRRDYEERKEAMSSSSSNREYGNFGTRFSWSGMGVDTTHSRASQQASNMSDALSEQSYTDNQVNLNFEVEKLRAELRHVQEMYAVAQTETFDASRKLGELNQRRLEEAIKLEELKLKEYEARELAEKEKQNFEKARRDAESMRERAEREIAQRREAERKSARDTKEKEKLEGTLGSPQLQYQHFAWEEIMAATSSFSEELKIGMGAYGAVYKCNLHHTTAVVKVLQSAENQLSKQFQQELEILSKIRHPHLVLLLGACPEQGALVYEYMENGSLEDRLFQVNNSPPLPWFERFRIAWEVAAALVFLHKSKPKPIIHRDLKPANILLDHNFVSKVGDVGLSTMVQVDPLSTKFTIYKQTSPVGTLCYIDPEYQRTGRISSKSDIYSFGMILLQLLTAKPAIALTHFVESAMDSNDEFLKILDQKAGNWPIEETRELAALALCCTELRGKDRPDLKDQILPALENLKKVAEKARNSFSGVSTQPPTHFICPLLKDVMNEPCVAADGYTYDRHAIEEWLKEHNTSPMTDSPLHSKNLLPNYTLYTAIMEWRSTR

>At5g18330.1 68418.m02157 U-box domain-containing protein weak similarity to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582198; contains Pfam profile PF04564: U-box domain

MADSTADESTNADTLWRELHKVLPEIWYDGGGKDHCEIDEAIRILTCLRKIESKNPESDISPVEVPKEFICTLSNKIMIEPMLIASGQTFEKSYILEWLKHERTCPRTKQVLYHRFMIPNHLINEVIKEWCLIHNFDRPKTSDEVIDLFTGDLESLLQRISSPSSVEDQTEAAKELALKAKRFSSVCVYFVAKIPDSITRLLTPLSISEDSNPEFLENIVTALHIFSTSEKNKTLVAENPLVLPLLAKYMKQGTVLTRIHSAATVNSLSYTDSNKIIIGNSEVLKALIHVIEEGDSLATSEAFSALSNLCPVKEISEKAVSEGLIRAAIKKIKAGSNVSMLLSLLAFVSTQNHQTTEEMDNLGLIYDLFSILRNSNSLVNDENAVVIVYNICKSYKALQNVVLREEKRDVVLEEENKHGTFTRLENQEAGRATSLAKRILEWILR

>At5g18320.1 68418.m02156 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain

MADSTETNADTLRRELQKVLTEILNDGGGNDRDETEAFSGVVKAIDEAVRILTCLRKVESKIPESDISPVEVPKEFICTLSNTIMIEPVIIASGQTYEKRYITEWLKHERTCPKTKQVLSHRLWIPNHLISDLITQWCLVNKYDHQKPSDELVAELFTSDIEALLQRVSSSSSVADQIEAAKELRHQTKKFPNVRVFFVAGIHDSITRLLSPLSTLDEAVDSSLELQENIVTALFNLSILESNKTVIAENCLVIPLLTKSLKQGTDETRRNAAATLSSLSAIDSNKIIIGNSEAVKALIDLIEEGDLLATKEATSTVFNLCIVLENKGKVVSAGLIHAATKKIKAGSNVDELLSLLALISTHNRAVEEMDKLGFIYDLFSILRKPSSLLTGENAVVIVFNMYDRNRDRSRLKVVGEEENQHGTFTKLAKQGSVRAARKAQGILQWIKRFVTGKEPQRA

>At1g56040.1 68414.m06434 U-box domain-containing protein contains Pfam profile PF04564: U-box domain

MVENSYVLFARLCVELFHELPPLPSDESHGDITTFERLFLRKCRIELENASPKTEHLPLVYVDETNYYRFIKTVRVLAEVYKNSKITETTRKSMIQVLMNPILPPERITDAMNLFRSIIGKLADFHFSDEKFNQLVRSSRVVELEGNYNEEVKLRKEAEDALAMKKEDVEMMEQLLESYKEEQGKLQLQAKALEHKLEAELRHRKETETLLAIERDRIEKVKIQLETVENEIDNTRLKAEEFERKYEGEMILRRESEIALEKEKKELEEVKLKLETYEREQENLSSEVRTWQDKYEQESSLRKLSEYALSREQEELQIVKGLLEFYNGEADAMREERDKALKTAKEQMEKRQPPSSFFCPITQASPNLYKKMITCITLNLEVMKDPHFAADGFTYEAESIRKWLSTGHQTSPMTNLRLSHLTLVPNRALRSAIEELV

>At1g60190.1 68414.m06780 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain

MIHTPTGSSRRILTFPAVNPCESISLTTLVDSLLQLAGEILSFKPKHFSTNKRSVKETLRHVQTLVIFFEELRIQIRVGSIPAGRSVILSLSELHVIFQKLKFLLDDCTRDGAKLYMLMNSGQVSAHFRDLTRSISTSLDTFPVRSVDLPGEVNELIYLVMRQTRKSEARPDRDDKRAIDSVYWFFNLFENRINPNSDEILRVLDHIGVRKWRDCVKEIDFLREEISVGKKSNIEIELLSNLMGFICYCRCVILRGIDVDDEEKDKEEDDLMMVRSLNVDDLRCPISLEIMSDPVVLESGHTYDRSSITKWFASGNITCPKTGKTLVSTVLVDNFSVKQVIQSYSKQNGVVMGQKGKKKVDVAESLAAEEAGKLTAEFLAGELIKGDEEEMVKALVEIRILTKTSTFYRSCLVEAGVVESLMKILRSDDPRIQENAMAGIMNLSKDIAGKTRIVGEDGGGLRLIVEVLNDGARRESRQYAAAALFYLSSLGDYSRLIGEISDAIPGLVRIVKSCDYGDSAKRNALIAIRSLLMNQPDNHWRILAAGIVPVLLDLVKSEEISDGVTADSMAILAKMAEYPDGMISVLRRGGLKLAVKILGSSEVSPATKQHCVALLLNLCHNGGSDVVGSLAKNPSIMGSLYTASSNGELGGGKKASALIKMIHEFQERKTGPGEPVLERERFVHAW

>At2g19410.1 68415.m02264 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain

MVVMLTQEMSGGGGPKAEEGQLFVAVAVKGLIGDKLGGAGSRRAVRWAVDNLLPKADKFVMIHVIPTITSIPTPNILILMFTRMWVVTAGDRLPVEEVEESVVEMYVRDVKKEYETVFVPFLKMCKSTRSTKRYFRSRRTKGTGVPLTVLRYAPETCEVYIVCKDRITTKSMDPLINREPCTSPHAAATAHDFLRDWAASFHTLRSPTLPDPRQSTEAGTRRSASARELRFEALSLTCNKPKTPQSSKASSATTPEIFRRRRGSDIPQLNYSDFDKTCTKPQSNVENIVSEHRDSDRSPPETSRKSKKVEIEEEVERLKNELQSTVFKYKQACEELFSTQNKVKMLSTEYLNESKRVNNAVEKEELQRNTAALEKERYMKAVKEVETAKALLAREFCQRQIAEVNALRTYLEKKKVIDQLLGTDHRYRKYTIEEIVTATEGFSPEKVIGEGGYGKVYQCSLDSTPAAVKVVRLDTPEKKQEFLKEVEVLSQLRHPHVVLLLGACPENGCLVYEYLENGSLEEYIFHRKNKPPLPWFIRFRVIFEVACGLAFLHSSKPEPIVHRDLKPGNILLNRNYVSKIADVGLAKLVTDVAPDNVTMYRNSVLAGTLHYIDPEYHRTGTIRPKSDLYAFGIIILQLLTARNPSGIVPAVENAVKKGTLTEMLDKSVTDWPLAETEELARIGLKCAEFRCRDRPDLKSEVIPVLKRLVETANSKVKKEGSNLRAPSHYFCPILREIMEEPEIAADGFTYERKAILAWLEKHNISPVTRQKLDHFKLTPNHTLRSAIRDWKSRVRFSNVVV

>At5g18340.1 68418.m02158 U-box domain-containing protein weak similarity to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain

MADSTADATETNADTLTLRRELKKVLTENLNDGGVKDRVETVKSIDEAIRILNRLKIVESKKRKRESDSSSVEVPKEFKCTLSKTIMIDPVIIFSGQTYEKRYITEWLNHDLTCPTAKQVLYRVCLTPNHLINELITRWCLANKYDRPAPKPSDIDYVTELFTDGIESLLQRISSPSSSVADQTEAAKELALQTEKFVNVRDFFIKELPDSITRLLTPLSVLGDEVDSNPELQENIVTALFNMSTFEKNKTVLAENHQVIPLLAKSMKQGSVVTRRNATLTLASLSDIDSNKIIIGNSVALKALIDLIGELDDLSATHDALCAVIDLCCDERENWKKAISLGLAPAAIKNIKARRNLFESLAALALISPHERVIQEVANLGVIYDLLSILRKTSCMVTCENAVVIVGNMYAKSRERSIKKILAEEENQHKTFTKIATQGSVVAVMKAQGILQCINY

>At4g36550.1 68417.m05190 U-box domain-containing protein low similarity to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain

MQKSTSSSASPDEIKDFHYAALKLQLSTPEAIVTERRSLKIICEDHKQNSFTHHQSIDDSLHANAAEAEASEEHNGTLPEKFKCTLSRTVMYDPVIISSGNTFERMQIQKWFDEGNDSCPISKRKLDDFTLKPNVELKSQISEWCAKNGLDVQDPARKHVKASNSIDFSVSIASFGSSLYNIPDHSGISITDFNSSYSIDSSSYSKMSKGGYFTPMQRIDSASGAGDTDSSHSEIEIDPLCGLTNLPWDAQIKVVEDVRSRFEHSTRAFRSMSPSKFLEPLITYLKNALERNGTAGEIIKGGLDLLLAFLSGNRRAIESLEEEVFKMFSVFLESEVVAEEALNILEVLSNHPHGPSKITSSGSLSSLLKIVESQAEHLQEQAMITLKNLSSSMEICLEMVSLDFIQKLTSFLQQKVFCKHSIIILKNLCSTEKGRGCITETPDCLASIAELLESNVPEEQENAISILLQLCVQKIEYCCLVVREATDIYSSLILISNNGTEEVKVSASELLRALVEVDSDKEEEEEVSSRPEGRTTASPTSQVVTPVTHPEPVKITPSPKKSGLFGFNFSSLKKKKK

>At1g10560.1 68414.m01189 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain

MIHTKTGSGRRILTFPTVEPSESISIVTLLDSLIQLAGDILTFKSKHFSTNKQSFRETLRRIQNLLVVFEEIRIRIRNSRRYFHDSAAASSLKEIHVGFQKLKFLLEDCTRDGARLCMMMNSDQVSDHLRVLTRSISTSLSAFPVASVDLTTEVNELIDLVVRQARKYGVQPETNDKRAVSSINRILALFVNRVVPDPDEINRILDHVGIRKWGDCVKEINFLGEEIDAERLDEKKKKSSDQVELLSSLMGFICYCRCIILGRIERDDHHNHHEDGIKKDHDLIRGLKVEDLLCPISLEIMTDPVVIETGHTYDRSSITKWFGSGNITCPITGKILTSTELVDNVSVRQVIRKHCKTNGIVLAGISRRRKSHDDVVPESLAAKGAGKLIAKFLTSELINGGEEMIYRAVREIRVQTKTSSFNRSCLVKAGAVTPLLKLLSSVDIRIQENAMAGILNLSKHVTGKSKIAGEGLKILVEILNEGAKTETRLYSASALFYLSSVEDYSRLIGENPDAIPGLMNIVKGDDYGDSAKRSALLAVMGLLMQSDNHWRVLAAGAVPILLDLLRSGEISGGLTADCLATLAKLAEYPDGTIGVIRRGGLKLAVKILSSSEDSPVAVKQHCVGLILNLCLNGGRDVVGVLVKNSLVMGSLYTVLSNGEYGGSKKASALIRMIHEFQERKTGSVEPNLQRGRFVHAW

>At3g11840.1 68416.m01451 U-box domain-containing protein low similarity to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain

MNIYTYTKSYVFPQMDQEEEEIEIPNYFICPISLEIMKDPVTTVSGITYDRQNIVKWLEKVPSCPVTKQPLPLDSDLTPNHMLRRLIQHWCVENETRGVVRISTPRVPPGKLNVVEEIKNLKKFGQEALGREETLQKLEVLAMDGNNRRLMCECGVHKSLILFVVKCTSEDEDGRRRIKGLDESLRLLHLIGIPSNDAKTILMENDRVMESLTWVLHQEDFLSKAYTIVLLRNLTEYTSSHIVERLNPEIFKGIIGFLKDVVNSVNRTSPTVRETVQSSSRPSLGKTEPSKLDHSLVIKQAVTAALMILLETSSWSRNRSLLVDLGAVSELIELEISYTGEKRITELMLGVLSRLCCCANGRAEILAHRGGIAVVTKRLLRVSPAADDRAISILTTVSKFSPENMVVEEMVNVGTVEKLCSVLGMDCGLNLKEKAKEILKDHFDEWKKFPCIDITLLTKLLSISPKGPKI

>At5g65920.1 68418.m08297 U-box domain-containing protein low similarity to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain

MPMFQPSKNGGFDGHILDLHSAVKDGVLGGGDGKFLVVVTDEKKKLDLKEMISELELPEIPSVFICPISLEPMQDPVTLCTGQTYERSNILKWFNIGHCTCPTTMQELWDDLVTPNKTLHQLIYTWFSQKYVLMKKRSEDVQGRAIEILGTLRKAKGKAKVHALSELKQVVMAHAIAKKTVVDEGGVFVISSLLSPFTSHAVGSEAIAILVNLELDSDSKAGLMQPARVSLMVDMLNDGSIETKINCARLIGRLVEEKGFRAELVSSHSLLVGLMRLVKDRRRRNGVSPALTLLKSVSVHKQVRNLLVRIGAVPQLVDVLPCLDVECLESALFVLDSLCLESEGRIALKDSVNTIPHTVRLLMKVSEKCTNYAISILWSVCKLASEECSSLAVEVGLAAKLLLVIQSGCDPALKQRSAELLKLCSLHYSDSMFISKCKLTRTIQ

>At3g49810.1 68416.m05446 U-box domain-containing protein contains Pfam profile PF04564: U-box domain

MPMFQPLKRDGLIGFEGGGDGQVLDLDTAVKDGVLGGVNGGGVGVVDEKLDLKKMIKELDLQDIPSVFICPISLEPMQDPVTLCTGQTYERLNIHKWFNLGHLTCPTTMQELWDDTVTPNKTLHHLIYTWFSQKYVLMKKRSEDVQGRAIEILGTLKKAKGQARVHALSELKQIVIAHLMARKTVVEEGGVSVISSLLGPFTSHAVGSEVVAILVSLDLDSDSKSGLMQPAKVSLIVDMLNDGSNETKINCARLIRGLVEEKGFRAELVSSHSLLVGLMRLVKDKRHRNGVSPALRLLKPISVHKQVRSLMVSIGAVPQLVDILPSLDPECLELALFVLDALCTDVEGRVAVKDSANTIPYTVRVLMRVSENCTNYALSILWSVCKLAPEECSPLAVEVGLAAKLLLVIQSGCDAALKQRSAELLKLCSLHYSDTMFISKCKLTRTIQ

>At1g56030.1 68414.m06433 MIF4G domain-containing protein / U-box domain-containing protein low similarity to intermediate filament filarin [Hirudo medicinalis] GI:4761082; contains Pfam profiles PF02854: MIF4G domain, PF04564: U-box domain

MVKNSYVLFARLCVELPPLPSDESHGEITTVERQFLRNCQMELENLSLKTELPLVYVDESKYWRFIKTVRVLAEVFNNMKTTRTTRKSIIQVLMNPILPSERSTDAMNLFLSTIEKLADLQFSDEDFNQLFVSSRLDLQLENKYNDKVEVKLRKEAEDALARKIKEVVDLTERLLQVEALEHKHKAKLQLRTETETAVAIERDYMRWKAEIFESEFNNQLVLRRESEIALDKERKELEGIKNLLETCFTGQKNLKSQVITWKDKYDQGSSIRKEKEVALSTKKLELEIFKQLAGSYKQDADAMRQERDNALKTDVMKNPHMAADGFTYELEAIQKWINTGHRTSPMTNLKLSHFSFFPNRALRSAIEELGR

>At3g47820.1 68416.m05211 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain

MPQHNSPGETPTEFLCPITGFLMSDPVVVASGQTFERISVQVCRNLSFAPKLHDGTQPDLSTVIPNLAMKSTILSWCDRNKMEHPRPPDYAYVEGVVRTRMDSLPPGSGHRIAKSEILPPVAENSNSNSDYDSVMGAIRSRSRTSLSSTTSLPLHQTRPINHSTRIQSSFSTSDYSSFPPMSPEEEEIYNKLTSVDTIDHEQGLIQLRKTTRSNETTRISLCTDRILSLLRSLIVSRYNIVQTNAAASIVNLSLEKPNKLKIVRSGFVPLLIDVLKSGSTEAQEHVIGALFSLAVEEENKMVIGVLGAVEPLLHALRSSESERARQDAALALYHLSLIPNNRSRLVKAGAVPMMLSMIRSGESASRILLLLCNLAACSEGKGAMLDGNAVSILVGKLRESGGAESDAAARENCVGALLTLSVGNMRFRGLASEAGAEEILTEIVESESGSGRLKEKASKILQTLRGGGSEFGEGAEAREWNRMLEASGLSRSQFQQGGQKGGFAYSSQF

>At5g62560.1 68418.m07851 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain

MGGNKQRWFSFHQRSSSATTTTLPQHKHDETPPEFLCPITGFLMSDPVVVSSGQTFERLSVQVCRNLGYIPDLLDGTRPDLSTVIPNLAMKSTIFSWCDRQKVDHPRPPDAAYVEGVVRARMDKDPNPSPGQSPGPGDKDPEPEILPPVEENSPSDYDAVMEAIRARSKNSMSPTTSLESVTIGQSSYHPVRAVSMFSSSTTSSSSGVFAGADSPFRNAMSFSSTDHSSSPMSPEEEEIFNKLRGTDIFDHEQGLILLRKMTRSSEDLRVSLCTDRILSFLRSLLVSRYNLVQTNAAASVVNLSLEKQNKVKIVRSGFVPLLIDVLKSGTTEAQEHVAGALFSLALEDENKMVIGVLGAVEPLLHALRSSESERARQDAALALYHLSLIPSNRTRLVRAGAVPTLLSMVRSGDSTSRILLVLCNLAACPDGKGAMLDGNAVAILVGKLREVGGGDSEAARENCVAVLLTLCQGNLRFRGLASEAGAEEVLMEVEENGNERVKEKASKILLAMRGGGGGESEFGENAEAREWNRMLEATGLSRTQFQGGQNGGFAYSSQF

>At5g40140.1 68418.m04871 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain

MEIQRPVINLMVLHSQHDKSDNLSRRESLAGKSKWRTSLSRSSSSSSSNNNSPTKTEIPAEFLCPISGSLMADPIIVSSGHSYERACVIACKTLGFTPTPPPDFSTVIPNLALKSAIHSWCERRCFPPPKPLNSAAAEKLILALMEKKPQRRKVSVSEKELIQAIRDKPSVRLNHAATELDRRPNYFNSSSDESIASSSRTLQLTTKPSCFSSPSSGEIESLEPNLTPEEEALLTKLKSNRISEIEEALISIRRITRIDESSRISLCTTRVISALKSLIVSRYATVQVNVTAVLVNLSLEKSNKVKIVRSGIVPPLIDVLKCGSVEAQEHSAGVIFSLALEDENKTAIGVLGGLEPLLHLIRVGTELTRHDSALALYHLSLVQSNRGKLVKLGAVQMLLGMVSLGQMIGRVLLILCNMASCPVSRPALLDSGGVECMVGVLRRDREVNESTRESCVAVLYGLSHDGGLRFKGLAMAANAVEELVKVERSGRERAKQKARRVLEVLRAKIEDDDLVENEEIDWEELLNSGDVSRSRCRLGGEKSCVNSAEF

>At1g20780.1 68414.m02602 armadillo/beta-catenin repeat protein-related / U-box domain-containing protein low similarity to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain

MVGSSDGDQSDDSSHFERGVDHIYEAFICPLTKEVMHDPVTLENGRTFEREAIEKWFKECRDSGRPPSCPLTSQELTSTDVSASIALRNTIEEWRSRNDAAKLDIARQSLFLGNAETDILQALMHVRQICRTIRSNRHGVRNSQLIHMIIDMLKSTSHRVRYKALQTLQVVVEGDDESKAIVAEGDTVRTLVKFLSHEPSKGREAAVSLLFELSKSEALCEKIGSIHGALILLVGLTSSNSENVSIVEKADRTLENMERSEEIVRQMASYGRLQPLLGKLLEGSPETKLSMASFLGELPLNNDVKVLVAQTVGSSLVDLMRSGDMPQREAALKALNKISSFEGSAKVLISKGILPPLIKDLFYVGPNNLPIRLKEVSATILANIVNIGYDFDKATLVSENRVENLLHLISNTGPAIQCKLLEVLVGLTSCPKTVPKVVYAIKTSGAIISLVQFIEVRENDDLRLASIKLLHNLSPFMSEELAKALCGTAGQLGSLVAIISEKTPITEEQAAAAGLLAELPDRDLGLTQEMLEVGAFEKIISKVFGIRQGDIKGMRFVNPFLEGLVRILARITFVFNKEARAINFCREHDVASLFLHLLQSNGQDNIQMVSAMALENLSLESIKLTRMPDPPPVNYCGSIFSCVRKPHVVNGLCKIHQGICSLRETFCLVEGGAVEKLVALLDHENVKVVEAALAALSSLLEDGLDVEKGVKILDEADGIRHILNVLRENRTERLTRRAVWMVERILRIEDIAREVAEEQSLSAALVDAFQNADFRTRQIAENALKHIDKIPNFSSIFPNIA

>At1g76390.1 68414.m08877 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain

MAGSGSWDGSQSDNSSQFEPGIDNIYEAFICPLTKQVMHNPVTLENGQTFEREAIEKWFQECRENGQPLSCPITSKELSITDLSPSIALRNTIEEWRARNDALKLDIARQSLYLGNAETNILLALKNVREICRNIRKIRQRVCNPQLVRLITDMLKSSSHEVRCKALQTLQVVVEGDEESKAIVAEGDTVRTIVKFLSQEPSKGREAAVSVLFELSKSEALCEKIGSIHGAIILLVGLTSSKSENVSTVEKADKTLTNLERSEENVRQMAINGRLQPLLAKLLEGSPETKVSMAFYLGVLALNNDVKVIVAQTVGSSLIDLMRTRDMSQREAALGALNNISSFEGSAKLLINTGILPPLIKDLFYVGPNQLPIRLKEVSATILANIVNIGYDFDKVPVGPHHQTLVSEEIVENLLQLTSNTGPEIQGKLLAVLVGLTSCPNSVINVVSAIRNSAAIISLVQFVEIHENDDLRLASIKLLHNISPHMSEELANALRSTVGQLGSLVSIISENTPTITEEQAAAAGLLAELPERDLVLTMRLLREGAFEKIISKIVGIRQGEIRGIRFERTFLEGLVSILARITFALTKETDATLFCCEKNLPSLFLDLLQSNSQDNIQRASATALENLSLESKNLTKIPELPPPTYCVSIFSCLSKPPVVLGICKIHQGICSVRESFCLVEGQAVDKLVDLLDHENDKVVGPALAALSTLLEDGLDVVQGVRLIDEADGITPILNVLLENRTENLRIRAVWMVERILRIEEIAREVGEEQNVTAALVDAFQNADFRTRQIAEKALRHIDKIPNFSGIFTNIG

>At1g68940.1 68414.m07891 armadillo/beta-catenin repeat protein-related / U-box domain-containing protein ; contains Pfam profile PF04564: U-box domain

MEIQTAESNVICSIDIFESLSDSVDVAKKLVEKSQESNEAESTTDLRSIEAGFEGVVKQMGETLQSIPESTFDEEEYIGVVIQSLSNEMQNATIGDGSKSEMINNGQQKISAKHTPDIVSEQMEEDLYPTDPEFSYESYMMYSESQSQMTDIPDIPSKSTDVSRQRKHGNHSESQSLVTEIPDIPSQSTNVSSQRKHGNLSKSQSQSTEIPDIPSQSSNASSQRKYGNLSESLSMLPQVTQFMEPPYQAFICPLTKEIMEDPVTTETGVTCERQAVIEWFDSFGNSDEINCPVTGQKLTTELSANVVLKTIIQEWKVRNEAARIKVAHAALSLGGSESMVIDALRDLQMTCEGKEYNKVQVREAGIIQLLDRYLTYRSKDVRFELLKFLRTLADEETDDGKEMIVKTITMSCVIKLLGSSHQPVRHAAQALLLELSKSQHACEKIGTARGAILMLVTAKYNRELDSFASETSDQILRNLEKCPENIKQMAESGLLEPLLGHLAEGSEETQVAMAAYLVEIDIGHEKKTYVAEKACPALIGLVQSENIDARRAAFKALAHISLYHPNNKILVEVGIIKIMVEEMFTKRVFSDLMNSRNEAATILANILESGLEHETFEVNTHGHTLGSDYFVYNIIHMLKNSSPDDLNIDLIRILLSLSKSPRAMATIVSVIKETDASFAMIELINNPHDELGVGALKLLIALTPYIGHTLSERLCKTRGQPENLIQCPVEANQITEKHAVSAKLLAKLPHQNLTLNLALVNESIVSEILHAIHLIQRSGARTSRYATDFLEGLVGILVRFTTTLYEPQMMYLARNHDLTSVFVDLLMKTSSDEVQRLSATGLENLSSTTMTLSRPPQPRSTKFMGSLSMPRSFSLRSSKKKQIEICAIHRGVCSAKNTFCLVEANAITKLLACLQSDKVEVVESALAAICTLLDDKVEVEKSLSMLSEMNAVQLILNAVKEHKKESLLQKAFWMIDKFIIRGGDKYASEISQDRMLSGMLVSAFHRGDGNTRQMAENILRRLDKMPSFSTYIT

>At5g65200.1 68418.m08200 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain

MGKNGRLRWNPFSHRSSSSTSSSSRQQQQEQQPPVEFLCPISKSVMSDPVVVSSGQTFERVCVQVCRDLNFIPKLNDDEESLPDFSNIIPNLNMKSTIDTWCDTVGVSRPQPPDYSTVERILRQQMPPPDVEIRVSEQELLRAVAHRAPMIIHHADSELMGRRDFNNSTTSSDESVIVAHSPFTPLPLTTRPACFSPSPSSSSSEIETLTHHTFFSNSTSTATEEDEVIYNKLKSSEIFDQEQGLIMMRKMTRTNDEARVSLCSPRILSLLKNMIVSRYSLVQTNALASLVNLSLDKKNKLTIVRLGFVPILIDVLKSGSREAQEHAAGTIFSLSLEDDNKMPIGVLGALQPLLHALRAAESDRTRHDSALALYHLTLNQTNRSKLVRLGAVPALFSMVRSGESASRALLVICNLACCSEGRSAMLDANAVAILVGKLREEWTEEPTEARSSSSARENCVAALFALSHESLRFKGLAKEARAVEVLKEVEERGTERAREKAKKILQLMRERVPEDDEEDGEGSIDWDRVIDSNGSIRSRFRVGGRNRVVTQNSSGF

>At5g67530.1 68418.m08515 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein contains Pfam domain, PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type

MGKKQHSKDRMFITKTEWATEWGGAKSKENRTPFKSLPYYCCALTFLPFEDPVCTIDGSVFEITTIVPYIRKFGKHPVTGAPLKGEDLIPLIFHKNSEGEYHCPVLNKVFTEFTHIVAVKTTGNVFCYEAIKELNIKTKNWKELLTEEPFTRADLITIQNPNAVDGKVTVEFDHVKNGLKIDDEELKKMNSDPAYNINVSGDIKHMLADLGTDKAKEIALHGGGGNKARNERAAAIAAILESRSKIKEVSKAEQPKQTYSVVDAASASVFGRSADAAKAGSSDKTAARIAMHMAGDRTPVNSKMVKSRYSSGAASRSFTSSAFTPVTKNDFELIKVEKNPKKKGYVQFQTTHGDLNIELHCDIAPRACENFITLCERGYYNGVAFHRSIRNFMIQGGDPTGTGKGGESIWGKPFKDEPNSKLLHSGRGVVSMANSGPHTNGSQFFVLYKSATHLNYKHTVFGGVVGGLATLAAMENVPVDESDRPLEEIKIIEASVFVNPYTELDEEEEKEKAEKEKNEDKDIEKIGSWYSNPGSGTTEAGAGGGGVGKYLKAMSSTATKDTKGSLDSDISTIGVSKKRKTTASASTGFKDFSSW



>At2g33340.1 68415.m04086 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to cell cycle control protein cwf8 (SP:O14011) [Schizosaccharomyces pombe (Fission yeast)]

MNCAISGEVPVEPVVSTKSGLLFERRLIERHISDYGKCPVTGEPLTIDDIVPIKTGEIIKPKTLHTASIPGLLGTFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDSACRVIARLKKERDEARQLLAEVERHIPAAPEAVTANAALSNGKRAAVDEELGPDAKKLCPGISAEIITELTDCNAALSQKRKKRQIPQTLASIDTLERFTQLSSHPLHKTNKPGICSMDILHSKDVIATGGVDATAVLFDRPSGQILSTLTGHSKKVTSVKFVGDSDLVLTASADKTVRIWRNPGDGNYACGYTLNDHSAEVRAVTVHPTNKYFVSASLDGTWCFYDLSSGSCLAQVSDDSKNVDYTAAAFHPDGLILGTGTSQSVVKIWDVKSQANVAKFDGHTGEVTAISFSENGYFLATAAEDGVRLWDLRKLRNFKSFLSADANSVEFDPSGSYLGIAASDIKVYQTASVKAEWNLIKTLPDLSGTGKATCVKFGSDAQYVAVGSMDRNYGYLVFLVMKKPTSMMTLRKTREQSVKNSDRTFQMSISSVISLKFLKFCCILQYLQQWGRIS


База данных защищена авторским правом ©shkola.of.by 2016
звярнуцца да адміністрацыі

    Галоўная старонка